KEGG   Halomonas elongata: HELO_2822Help
Entry
HELO_2822         CDS       T01311                                 

Definition
(GenBank) aldolase domain protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hel  Halomonas elongata
Pathway
hel00051  Fructose and mannose metabolism
hel01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HELO_2822
Enzymes [BR:hel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HELO_2822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: CBV42706
UniProt: E1V3M7
Position
2116530..2117309
Genome map
AA seq 259 aa AA seqDB search
MTTMQTPKDELVRNAEKQMRTGLSDNTWTDTQKLALTCRILFDGGHDSGLAGQITARGPQ
PGTYYTQRLGLGFDEISANNLLLVDEDLNVLEGNGIPNPANRFHSWVYRARNDVNCIIHT
HPLHIAALSMLEVPLAVSHMDICPLFEDCAFLESWPGVPVGNEEGEIISEALGDKRAILL
AHHGQLSTGQSIEEACVIAMLIERAAKLQLLAMSAGEIRSIPPELGREAHDWISKPKRHG
AAFNYYARRALRQHSDCLS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccatgcagacacccaaagatgaactggtccgcaacgctgaaaagcaaatgagg
accggcctcagtgataatacctggaccgacacccaaaaactggccttgacctgccggatc
ctcttcgacggtgggcacgactcgggactcgccggccagatcacggctcgcggcccccag
cctggaacctattacacccaacgtcttggattggggttcgacgagatcagcgccaacaac
ctgttgctggtagacgaagacctcaatgtccttgaaggaaacggcattcctaatccagcg
aatcgcttccatagctgggtttatcgagctcgtaacgatgtgaactgcatcatccatacg
catccattgcatattgcagccctatcgatgctcgaagtgccgctggctgtgtcacacatg
gatatatgcccactctttgaagactgcgcctttctcgagagttggccaggcgtgccagtg
ggcaacgaggaaggcgagatcatctctgaggccttgggcgataagcgcgccatcctgctg
gcccaccacggacagctgtccaccgggcagtcgatcgaggaggcctgcgttatcgccatg
ttgattgaacgcgccgccaagctacagctcttggcgatgtcggctggcgagatccgctcc
atcccgccagagctgggccgcgaagcccacgactggatttcaaagcccaaacgccatggc
gccgctttcaactattacgcacgccgagccttgcgtcagcacagtgattgtttgagttga

DBGET integrated database retrieval system