KEGG   Halomonas elongata: HELO_2918
Entry
HELO_2918         CDS       T01311                                 

Gene name
vasC
Definition
(GenBank) T6SS cluster protein VasC
  KO
K11894  type VI secretion system protein ImpI
Organism
hel  Halomonas elongata
Brite
KEGG Orthology (KO) [BR:hel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hel02044]
    HELO_2918 (vasC)
Secretion system [BR:hel02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   HELO_2918 (vasC)
SSDB
Motif
Pfam: FHA
Other DBs
NCBI-ProteinID: CBV42802
UniProt: E1V3X3
Position
complement(2243291..2244613)
AA seq 440 aa
MNETFPQQQAITLVVTNSERLEGRSTSSHVFPAEGGTLGSGSSDDWLLQDHANRVRPGHA
EIQRLDGRFCLIDRCGQTFVNRATLPIGRERRVALRDGDELQVGEYWLRVHMGDRQAAVA
GVQPLATLVDEEHETLEGAEPVSATAVVTRPQHDPLEALGEVSSAQRHQDPMAALADETI
AGEDDHHELLDALDGQGATAGAPAAPRQRGYEDPDMNEHLLNDLERSVGEQLEERWQDEP
TGEVGHVGASPLLQTLGGELRFRDSAEQHAFLEEAGRTLKATVEGLLALHQAHDGSRYPL
RDRRLQPIEDNPLRLGQPYEQTLTTLFAAQRSPVHLSAPAAVTECLEHQQQHQAAVEEAI
GTALKSILDAFSPDALLKRFHAYRGAGRQGDDEGGWAWEMYRHYYQELNSGRQQGFEKLF
WEVFEQAYDQSVRRQQREDA
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgaacgagacgtttccccagcagcaggccatcactctggtggtcaccaacagtgaacgg
ctcgagggccgctcgaccagcagccacgtctttccggccgagggcggaaccctgggcagc
ggatcgtccgacgactggctgctgcaggatcacgccaaccgggtacgccccggccatgcc
gagatccagcgcctggacggtcgtttctgcctgatcgaccgctgtggccagaccttcgtc
aaccgcgcgactctgccgatcggtcgcgagcgccgtgtggcgctgcgcgacggtgatgag
ttgcaggtaggggaatactggctgcgggtgcacatgggcgaccgtcaggccgctgtcgcc
ggtgtgcagccactggcaaccctggtcgacgaggaacacgagacgctggagggcgccgag
ccggtgtcggccaccgccgtcgtgacgcggccccagcatgacccgctggaggcactgggc
gaggtttcatcggcgcaacgtcatcaggatcccatggccgcgctggccgacgagaccatc
gccggcgaggacgatcatcacgaactgctcgatgccctggacgggcagggcgctaccgct
ggtgcgccggccgcaccaaggcaacgaggttacgaggaccccgacatgaatgaacacctg
ctgaacgatctggaacgctcggtcggcgagcaactcgaagagcgctggcaagacgagcca
acaggagaggtcggccacgtcggcgcctcaccgttgctgcagaccctgggcggcgagttg
cgcttccgtgacagtgccgagcagcacgcctttctcgaagaggcggggcgcaccctcaag
gccaccgtggaaggcctgctggcactgcaccaggcccacgacggtagccgttatccgctg
cgcgaccgtcgcctgcagcccatcgaggacaacccgctgcgcctggggcaaccctatgag
cagacactgacgacactgtttgcggcccagcgcagcccggtgcatctctcggcgccggcg
gcggtgaccgaatgcctcgaacaccagcaacagcaccaggccgcggtggaggaagccatc
gggacggcgctcaagtcgattctcgatgccttctcgccggatgccttgctcaagcgcttt
catgcctatcgcggtgcaggtcgccagggtgatgacgaaggcggctgggcctgggagatg
tatcgccactactaccaggagctcaactcgggtcggcagcagggcttcgagaagctgttc
tgggaagtcttcgaacaggcctacgaccagtcggtgcgtcgccagcagcgggaggacgca
tga

DBGET integrated database retrieval system