KEGG   Halomonas elongata: HELO_2929Help
Entry
HELO_2929         CDS       T01311                                 

Gene name
hcp1
Definition
(GenBank) T6SS-related Hcp family protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
hel  Halomonas elongata
Pathway
hel03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hel00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HELO_2929 (hcp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hel02044]
    HELO_2929 (hcp1)
Secretion system [BR:hel02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   HELO_2929 (hcp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: CBV42813
UniProt: E1V3Y4
Position
complement(2259085..2259603)
Genome map
AA seq 172 aa AA seqDB search
MPTPCYISIEGQTQGNITAGAFTPESVGNIYVEGHEDEMLVQEFKHIVTVPTDPQSGQPS
GQRAHKPFIFTVALNKAVPLLYNALASGEMLPTVELKWYRTSVEGKQEHFFTTALTDATI
VDINLRMPHAQDANSAEFTQLMDVSLAYRKIDWEHTVAGTSGSDDWRAPIEG
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccccatgttatatcagcatcgaaggccagactcagggcaacatcaccgctggc
gccttcacgcccgaatccgtgggcaacatctacgtcgaaggccatgaagacgagatgctc
gtccaggaattcaagcacatcgtcactgtgccgacggatccgcagtccggtcagccgtcc
ggtcagcgtgctcacaagccgttcatcttcaccgtggccctgaacaaggccgtgccgctg
ctgtacaacgccctggcgtccggtgagatgctgcccacggtcgagctgaagtggtaccgc
acctccgtagaaggcaagcaggagcacttcttcaccaccgccctgaccgatgccaccatc
gtcgacatcaacctgcgcatgccccatgctcaggacgccaacagcgccgagttcactcag
ctgatggacgtctccctggcctaccgcaagatcgactgggagcacaccgtcgccggcact
tccggttccgacgactggcgcgccccgatcgaaggctaa

DBGET integrated database retrieval system