KEGG   Halomonas elongata: HELO_3735Help
Entry
HELO_3735         CDS       T01311                                 

Gene name
oadA
Definition
(GenBank) oxaloacetate decarboxylase alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
hel  Halomonas elongata
Pathway
hel00620  Pyruvate metabolism
hel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HELO_3735 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hel02000]
    HELO_3735 (oadA)
Enzymes [BR:hel01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     HELO_3735 (oadA)
Transporters [BR:hel02000]
 Other transporters
  Primary active transporters [TC:3]
   HELO_3735 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Peptidase_M23 PTS_EIIA_1 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: CBV43619
UniProt: E1V8G3
Position
complement(3207957..3209771)
Genome map
AA seq 604 aa AA seqDB search
MNENARPLGITDVVLRDAHQSLFATRLRLDDMLPIAEKLDRVGFRSLESWGGATFDACIR
YLGEDPWERIRALKEAMPNTPQQMLLRGQNLLGYRHYADDVVDRFVERAKTNGVDVFRIF
DAMNDPRNLERAIRAVRANEGHAQGTISYTVSPVHTIESWVELARSIADMGADSLAIKDM
AGLLTPYDAFELVSRLKKALDIPIHLHCHATTGMSTATALKAVEAGVDNVDTAISSMSMT
YGHSPTESLVAILKGTERDTGLDLELLEDIAGYFREVRKKYAAFEGALKGIDSRILVAQV
PGGMLTNMESQLKEQGAGDKLDDVLTEIPRVREDLGYIPLVTPTSQIVGTQAVMNVMMGE
RYKSISKEVQALLKGEYGAAPAAFDQELQTRVLEGAEPITERPADRLSPEMERLSEELTN
KASEDKIRLAEGERRIDDVLTYALFPQIGLKFLANRDDPEAFEPAPQAPENGSAPTTTPP
AKAQVPAADSTGPETYTVKVNGKTYVVEVAEGGEIGRVEEQAASPQAASAPAASSGEAIT
APLAGNIFKVNVKPGDSVAEGDVVIILEAMKMETEVRAASAGTVSEIKVSEGDSVAVGDE
LIVL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaacgcacgcccgctcggcatcaccgatgtagtgctgcgcgatgctcatcag
tcgctgtttgccacgcgcctgcgcctggacgacatgttgccgattgccgagaagctcgat
cgtgtcggcttccggtcgctggagtcttggggtggcgcgaccttcgacgcctgtatccgc
tatctcggcgaggatccgtgggagcggatacgggcgttgaaagaggccatgcccaatacg
ccccagcagatgctgctgcggggccagaacctgctcggctatcggcactacgccgacgac
gtggtcgatcgcttcgtcgagcgtgccaagaccaacggggtcgacgtcttccgcatcttc
gacgccatgaacgacccgcgcaacctggagcgtgccatccgggccgtgcgagccaacgaa
ggccatgcccagggcaccatttcctataccgtgagtccggtccacaccatagaaagctgg
gtggagctggcgcgttccatcgccgacatgggcgccgattccctggcgatcaaggacatg
gcgggcctgctcacgccctacgatgccttcgaactggtgtcgcgcctgaagaaggcgctg
gacattcccatccacttgcactgtcacgccaccaccggcatgtccacggccaccgcgctc
aaggccgtggaagcgggggtcgacaacgtcgataccgccatttcctcgatgtcgatgacc
tatggccacagcccgaccgaatcgctggtggccatcctcaagggcaccgaacgcgacacc
gggctcgaccttgaactgctcgaggacatcgccggctatttccgcgaggtgcgcaagaag
tacgccgccttcgagggtgcgctcaagggcatcgactcgcggattctggtggcgcaggtg
ccgggtggcatgctcaccaacatggagagccagctcaaggaacagggcgccggcgacaag
ctcgacgacgtcctgaccgagattccccgggtgcgcgaggatctgggctacatccccctg
gtgacgccgacctcgcagatcgtcggcacccaggcggtgatgaacgtgatgatgggtgaa
cgctacaagtccatctccaaggaagtgcaggccctgctcaagggcgagtatggcgccgcg
cccgccgccttcgaccaggagctccagacacgcgtcctcgaaggcgccgagcccatcacc
gagcgtccggccgatcgcctgtcgccggagatggagcggctttccgaggaactgacgaac
aaggccagcgaagacaagatccgcctggccgagggcgagcggcgtatcgatgatgtgctg
acctatgcgctcttcccgcagatcggcctgaagttcctcgccaatcgcgacgatcccgag
gccttcgagccggcgccccaggcaccggagaatggctccgctccgacgaccacgccgccg
gcgaaagcccaggtgccggccgccgactcgaccggtcccgagacctataccgtcaaggtc
aacggcaagacctatgtggtcgaggtcgccgagggcggcgagatcggccgggtggaggag
caggccgcgagccctcaggccgcgtcggcgccggccgcctcttcgggcgaggccatcacg
gcgcccctggcgggcaatatcttcaaggtcaacgtcaagccgggcgacagcgtcgccgag
ggcgatgtggtgatcatcctcgaggccatgaagatggagaccgaggtgcgtgccgccagt
gccggcactgtttcggagatcaaggtcagcgaaggtgacagcgtggccgtgggcgacgag
ctgatcgttctctag

DBGET integrated database retrieval system