KEGG   Halomonas elongata: HELO_3823Help
Entry
HELO_3823         CDS       T01311                                 

Gene name
mutM
Definition
(GenBank) formamidopyrimidine-DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
hel  Halomonas elongata
Pathway
hel03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:hel00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    HELO_3823 (mutM)
Enzymes [BR:hel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     HELO_3823 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     HELO_3823 (mutM)
DNA repair and recombination proteins [BR:hel03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     HELO_3823 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS Staph_haemo FbpA
Motif
Other DBs
NCBI-ProteinID: CBV43707
UniProt: E1V935
Position
complement(3316993..3317817)
Genome map
AA seq 274 aa AA seqDB search
MPELPEVETTRRGIAPHVEAREIREVIVRQSRLRHPVPEDLADRLVGAHLGRLDRRAKYL
LMPVVGERGGTLLCHLGMSGSLRIARLGELPKKHDHVDLVLDDGAILRYHDPRRFGFIDW
LDGDVARDRRLAKLGPEPLSEAFDGERLYAMSRKRRLAVKPFLMDNAVVVGVGNIYAAEA
LFLAGIDPRREAGRISRERYTRLAEAIREVLAAAITQGGTTLRDFVSGTGEPGYFAQRLN
VYGRDGEPCRRCGAELRLVTLGQRASVFCAACQR
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcttcccgaggtcgaaaccacccgacgcggcatcgccccgcatgtcgaggcg
cgcgagatccgcgaggtgatcgtgcgccagtcgcgcctgcgccacccggtgcccgaggat
ctcgccgaccgtctggtgggcgcgcatctgggccggctggatcgtcgcgccaagtacctg
ctgatgccggtggtcggcgagcggggcggaaccctgctgtgccacctgggcatgtccggc
agcctgcgcatcgcacggctgggcgagctgcccaagaagcacgatcatgtcgacctggtg
ctcgacgacggggctatcctgcgctatcacgatccgcgtcgcttcggcttcatcgattgg
ctggatggcgatgtcgcgcgggaccgtcggctggcgaaactggggccggagccgctctcg
gaggccttcgatggcgagcggctctatgcgatgtcccgcaagcgacggctggcggtcaag
cctttcctgatggacaacgccgtggtggtcggtgtcggcaacatctacgccgccgaggcc
ctgttcctggccggcatcgatccgcgccgcgaggcggggcgcatctcgcgcgagcgctat
acgcgcctggccgaggccatccgcgaggtgctggccgcggccatcacccagggaggcacg
acgctgcgcgacttcgtcagtggcaccggcgagccggggtatttcgcccagcggctcaat
gtctatggccgcgatggcgaaccctgccggcgctgcggtgccgagctgcgcctggtgacc
ctggggcagcgtgccagtgtcttctgtgccgcctgccagcgctga

DBGET integrated database retrieval system