KEGG   Halomonas elongata: HELO_4042
Entry
HELO_4042         CDS       T01311                                 

Gene name
tfc2
Definition
(GenBank) secretion cluster MPF-G protein Tfc2
Organism
hel  Halomonas elongata
SSDB
Other DBs
NCBI-ProteinID: CBV43926
UniProt: E1VA38
Position
3571520..3572170
AA seq 216 aa
MKHLLHLPLGTLALAVALAGCAQQQTHDAPSMAEQYPASQELAIASESADQPSVTQSPAK
PSGVGVKRQHVTPDIYQATDDHRIPVMRAGRYQLVTARATLGQRYLLEQMVDVNIPPSVA
STVGDGIRYTLEQTGYQLCSPEGDWQLQWLFNRPLPSAHYELGPMALREALQVLAGDEWE
LEQDALRREICYTRRDDFQPVYPRRVVKPAAEARHE
NT seq 651 nt   +upstreamnt  +downstreamnt
atgaaacacctgctccaccttccgctcggcaccctggcactggctgtcgctctcgccggg
tgtgcgcagcaacagacacacgacgctccctcaatggccgagcagtatcccgcgtctcag
gaactggccattgcgagcgaatcggccgatcagccatccgtcactcagtcgcccgccaag
ccgagtggcgtcggcgtgaagcgtcagcacgtcaccccggatatctaccaggcaaccgac
gatcaccgcatcccggtcatgcgggccggtcgctaccagttggtcactgcccgggcgacg
ctcgggcagcgctacctcctcgagcagatggtcgacgtgaatatcccgcccagcgtggcg
tcaacggtcggcgacggcatccgctacaccctggaacagaccggctatcagctgtgctcg
ccggagggggattggcagttgcagtggctgttcaaccgccccctgccgtcggcgcactac
gagctcggccccatggccttacgcgaggccctccaggtcctggccggcgatgaatgggag
ctggaacaggacgccctgcgtcgcgagatctgctacacccgccgcgatgacttccagccg
gtctatccgcgtcgcgtggtgaagcccgccgcggaggcacgccatgagtga

DBGET integrated database retrieval system