KEGG   Halomonas elongata: HELO_4045
Entry
HELO_4045         CDS       T01311                                 

Gene name
tfc3
Definition
(GenBank) secretion cluster MPF-G protein Tfc3
Organism
hel  Halomonas elongata
SSDB
Other DBs
NCBI-ProteinID: CBV43929
UniProt: E1VA41
Position
3573495..3574253
AA seq 252 aa
MSAKFPSHMTGLAGAVLLALAAPALAQTSWSEKISGQEASTAGEQQTHVDEIDREATQRS
RAEAWGLTDKQWSRYQKLKERPRGTWSPDLDPITMLGLEARSEDERRHYAELLVEQQRKR
VERELAFQKAYDAAWQRLYPEESRVNFFTLGRSQSAQSLLTSDTTGPVRYNVVVALEDCS
RCESEVRRLLDQGALMDIWVVDSDGNDDAIRQWATKVGIPADRVRQGQITLNHGGQRFSE
YEDALPRVMPRG
NT seq 759 nt   +upstreamnt  +downstreamnt
atgtcagccaaatttccctcacatatgacggggctcgccggcgctgtactgctggcactg
gcggccccggcactcgcccagacgtcatggtcagaaaagatctctggacaagaggcatca
acggcgggtgagcaacagacgcacgtcgatgagatcgatcgagaggcgacgcagcgttct
cgagccgaggcctggggactgaccgacaagcagtggtcacgctaccagaagctcaaggaa
cgcccgcgtgggacctggtcaccggacctcgaccctatcaccatgctcggcctcgaggcg
cgctccgaagatgagcgacggcattacgccgagctgttggtcgaacaacagcgcaagcgt
gtcgagcgcgaactggctttccagaaggcctatgacgccgcctggcagcgtctgtacccc
gaggagagccgcgtcaatttcttcacgctgggacgctcccaaagcgcccagtcgctgctg
acatccgatacgaccggccccgttcgctacaacgtcgtcgtcgccctcgaggactgcagc
cgctgtgagtccgaagtgcggcgtctgctggaccagggggccctgatggacatctgggtc
gtcgacagtgacggcaacgatgacgccatccgccaatgggccaccaaggtcgggatcccc
gctgaccgggtccgtcagggccagatcaccttgaaccacggcggccagcgcttctcggag
tacgaagatgcgctgccacgcgtcatgcctcgagggtaa

DBGET integrated database retrieval system