KEGG   Halomonas elongata: HELO_4047
Entry
HELO_4047         CDS       T01311                                 

Gene name
tfc5
Definition
(GenBank) secretion cluster MPF-G protein Tfc5
Organism
hel  Halomonas elongata
SSDB
Motif
Pfam: DUF2859
Other DBs
NCBI-ProteinID: CBV43931
UniProt: E1VA43
Position
3575010..3575558
AA seq 182 aa
MNPITVWIGLLGLSVSLTAQAQAPGVSPLEVVADHGGEPARPYYVAIGAAQVEEREGYHA
NVVGQAGQAAPVTDAHWLPVESERLSPGNVEARELELHAGMTPFFLVGDDPLSLKWLKAR
RDWLVEHHAVGLVVDVADTAGLERLRQRARGLELRPTSGDDIAARLGLNHYPVAITPQGL
SQ
NT seq 549 nt   +upstreamnt  +downstreamnt
atgaaccccatcactgtctggataggactgctgggactgagcgtgagcctgaccgcccag
gcgcaggcgcccggcgtctccccgctcgaggtcgtagccgatcacggcggcgagccggca
cgtccctattacgtcgccatcggcgccgcccaggtggaggaacgcgagggctatcacgcc
aatgtggtcggccaggccggacaagcggccccggtgaccgatgcccactggttgccggtg
gaaagcgagcgcctgtcacccggcaacgtcgaggcccgcgagctcgagcttcacgccggc
atgacaccgtttttcctggtcggtgacgaccccttgtcactgaagtggctcaaggcgcgg
cgtgactggctggtcgagcatcatgccgtgggtctggtggtcgatgtggcggataccgcc
ggcctcgagcgcctacgccaacgcgcccggggactggagctgcgccccacctcgggcgac
gacatcgccgcacgcctcggcctgaatcactacccggtggccatcaccccccaaggattg
agtcagtaa

DBGET integrated database retrieval system