KEGG   Halomonas elongata: HELO_4050
Entry
HELO_4050         CDS       T01311                                 

Gene name
tfc6
Definition
(GenBank) secretion cluster MPF-G coupling protein
Organism
hel  Halomonas elongata
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind
Other DBs
NCBI-ProteinID: CBV43934
UniProt: E1VA46
Position
3577741..3579945
AA seq 734 aa
MKQTHPLESLLRPAVEFNTTWVCLGCAVLCLYAPWSIALSPSVGWGMAAAFLVLGGWRAH
QGWTVLRYRRNMRRLPRFALRSDQIPVSSRSLWLGKGFKWEARHTQRLYDSQQPEAEAYI
QPPRRYRWARAIEQRLEGIRSLYFVIRLLSADTALNPVRPLPPVGGVAALHAVEWKEGSV
WMPLGERVGHTLVEGTTRVGKTRQAEVMITQDIHRVTHGDHEVVVCFDPKGDADLMLRMY
IEAIRAGRGDEFYVFHLGFPELSARYNAVGRFGRISEVATRIAGALPNEGNSAAFREFAW
RFVNIVARARHALGQRPSYEQILTDVVNIDSLLIEYARQTFEQQFPGAWEKIAAMEGQYN
DKNTPKNLQGRHKRVVAIVEYLQSPDINVSDSVLEGLLSAVRYDKTYFDKIVASLLPLLE
KLTSGQIAELLSPDYHDLEDTRPIFDWQQIVRKRGIVYIGLDALSDFEVAQAVGNSMFAD
LVSVAGHIYKHGVDDGMPGQSSGKVAINLHCDEFNELMGDEFIPLINKGGGAGIQVTAYT
QTLSDIEARIGNAAKAGQVVGNFNNLIMLRVRENKTAMQLTDQLHKVPIATRMLVSMAGD
NSDIDSDVDFSSSGGDRISTAPQPKLEPADIINLPKGQAFALLEGGQLWKIRMPLPKPDK
GKDIPANINDMAQQMRKRYNTGDRWWESVAPPPIEIDPELTAAAAGSPTVANPPPAPAEP
GLEVPGDDGMDVDD
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgaaacaaacccatccgctcgagtcgttgctccgccccgccgtcgagttcaacaccacc
tgggtgtgcctgggctgtgcggtgctctgcctgtatgccccctggtccatcgcgctctcg
ccgagtgtcggctggggcatggcagcggcctttctggtcctgggcggatggcgggcccat
caggggtggacggtgttgcgctatcgccgcaatatgcgccgcctgccgcgcttcgcgctg
cgcagcgaccagatcccggtcagctcgaggagcctgtggttgggaaaaggcttcaagtgg
gaggcgcgtcatacccaacggctctacgacagtcagcagcccgaagccgaagcctatatt
cagccaccacgccgctatcgctgggcacgagccatcgagcaacgcctggaaggcattcgc
tcgctgtatttcgtcatccgcctgctcagtgccgataccgccttgaacccggtgcgtcct
ctgccccctgtgggtggggtagccgcgctgcatgccgtcgaatggaaagagggttcggtt
tggatgccgctgggcgagcgggtcggccacaccctggtcgaaggcacgacgcgcgtcggc
aagacgcgtcaggccgaggtgatgatcacccaggacatccatcgggtcacccacggcgat
cacgaagtggtggtgtgcttcgatcccaagggcgatgccgacctgatgctgcgcatgtat
atcgaggccatccgggccggacgcggcgatgaattctacgtcttccatctcggttttccg
gagctgtcggcccgttacaacgcggtgggtcgcttcggccggatctcggaagtcgcgacc
cggatcgccggggcgttgcccaacgaaggcaacagcgctgccttccgcgagttcgcctgg
cgtttcgttaacattgtcgcgcgggcgaggcacgcgctgggccaacggcccagctacgag
cagatcctcactgacgtcgtcaacatcgacagcctgttgatcgagtacgcccgccagacc
ttcgagcagcagttccccggcgcctgggaaaagatcgcggcgatggaaggccagtacaac
gacaaaaacacgccgaagaacttgcagggacgccataagcgcgtggtagcgattgtcgaa
taccttcagagccctgatatcaacgtcagcgatagcgtcctcgagggcttgttgtcagcg
gtcagatacgacaagacgtatttcgacaagatcgtcgccagtctgctgccgcttttggag
aaattgaccagcggccagatcgccgagttgctttccccggactatcacgacctggaagac
actcgcccgatcttcgactggcaacagatcgtgcgcaaacgcggcatcgtctatatcggc
ttggatgcgctctcggatttcgaggtggctcaagcggtaggcaactcgatgttcgccgac
ctggtgtcggtcgccgggcatatctacaagcacggcgtcgatgacggcatgccgggccag
tctagcggcaaagtggccatcaacttgcactgtgatgagttcaacgagctgatgggcgac
gagttcattcccttgatcaacaaagggggcggtgcagggattcaagtgaccgcttatacc
cagaccctgtccgacatcgaggccaggatcggcaatgccgccaaagcgggccaagtcgtc
ggcaacttcaacaacctcatcatgctgcgcgtgcgcgagaacaagaccgccatgcagctc
accgaccagctccacaaagtgccgatagccacgcgcatgctggtctccatggcgggggat
aacagcgacattgacagcgatgtcgatttctcaagctccggaggagaccggataagcact
gcgccgcagcccaagctggaacccgccgatatcatcaacctgcccaaggggcaggccttc
gcgctgctcgagggcggccagctctggaagatccgcatgccgttgcccaaacccgacaag
ggcaaggacatcccggccaatatcaacgatatggcccagcagatgcgcaagcgctacaac
accggcgatcgctggtgggagtcggtggcgccgccgccgatcgaaatcgaccccgagctg
accgcggcggccgccggctcgccgacggtggccaacccgccgccggcgccggcagaaccc
ggattggaggtcccgggggatgatgggatggacgtcgatgattga

DBGET integrated database retrieval system