KEGG   Halomonas elongata: HELO_4056
Entry
HELO_4056         CDS       T01311                                 

Gene name
tfc12
Definition
(GenBank) secretion cluster MPF-G protein Tfc12
Organism
hel  Halomonas elongata
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: CBV43940
UniProt: E1VA52
Position
3582195..3582854
AA seq 219 aa
MSRYRHAVSGRDAHITTLRGIILLLAVGCVFLWKGWKDAPEELTVYYPPDLRGGTSQSAW
EIPPNNAYQFGWYVWQRLNRWPTNGEADYKRNIHALRPYMTPSCHRSLEQEYQKRRRRGE
LDGRTRGMYEIPGRGYRPGESVEILSDDSWLVKLDLGVEEHYAGTPVREFYARYPLRVVR
ANVDADNNPWGLQIDCLEGEARRLVTDPEGQATDEEEAE
NT seq 660 nt   +upstreamnt  +downstreamnt
atgagtcgttaccgccatgcggtgtccgggcgggacgcccatatcacgacccttcggggg
atcatcctgctgctggcagtgggctgcgtctttctctggaaggggtggaaagatgccccg
gaggaactgacggtctattacccccctgatttgcgcggtggcacctcgcagtccgcctgg
gagatcccgcccaacaacgcttatcagttcggctggtatgtgtggcagcggctcaaccgg
tggcccaccaacggtgaagcggattacaagcgcaacattcacgcattgcgcccctacatg
acgccctcctgtcatcggtccctggagcaggaatatcaaaagcgtcgccgccgcggcgaa
ctcgacgggcgcacgcgcggcatgtacgagatcccgggacgtggctaccggccaggcgag
tcggtcgagatcctcagtgacgacagctggttggtgaagctcgacctcggcgtcgaagag
cactacgccggcacgccggttcgtgagttctatgcgcgctatcccttgcgggtcgtgcgg
gccaatgtcgacgcggacaacaacccctggggactgcagatcgattgcctggaaggtgaa
gccagacgtctggtgacggaccccgaaggtcaagcgaccgatgaggaggaagccgaatga

DBGET integrated database retrieval system