KEGG   Halomonas elongata: HELO_4057
Entry
HELO_4057         CDS       T01311                                 

Gene name
tfc13
Definition
(GenBank) secretion cluster MPF-G protein Tfc13
Organism
hel  Halomonas elongata
SSDB
Motif
Pfam: DUF3438
Other DBs
NCBI-ProteinID: CBV43941
UniProt: E1VA53
Position
3582851..3583672
AA seq 273 aa
MKPIIKLGVVLGGCLLSLNAAAVQIMEWDHRPLDIELPVEAERLVILDRNVKVGLPRPIA
NPETLRVQSTGGVLYLKANEPFDTQRVQLKDAESGELLLVDLTATDDASHEDIKVVDAES
SDDAETSGSPKDGRSEGDADEPEVRSPVPVTLIRHAAQSLYAPLRTVEAIPGVKRVPMRL
PDTLPGLMPALPVEATPKAAWGVDGWTVTAVRLINQDPSREFELDPRWLQGRFYSASFMH
PTLGRKGSETAATTVFLVTRQGGLRDALARQGR
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagccgatcatcaagctgggggttgtcctgggcggctgcctgctgtcactgaacgcc
gcggcggtacagatcatggagtgggaccaccgaccgctggacatcgagcttccggtggag
gcggaacgcctggtgatcctggaccgcaatgtcaaagtcgggctgcccaggcctatcgcg
aaccccgagacgttgcgggtgcaaagtaccggcggcgtgctgtacctcaaagccaacgag
cccttcgatacgcaacgtgtccagctcaaggatgccgagtcgggtgagttgttgctggtc
gacttgaccgccaccgacgacgccagccacgaagacatcaaggtcgtggacgccgaatca
tcggatgatgccgagacgtcagggtcgccgaaagacggtcgcagtgagggtgacgccgac
gaaccggaggttcgctcaccagtgccggtgacgctgatccgtcacgcggcgcagtccctc
tatgcccccttgcgcaccgtcgaggcaattcccggcgtcaagcgggtacctatgcgcctg
ccggacaccctgccggggctgatgcccgccttgccggtcgaggcgaccccgaaagcggcc
tggggcgtcgatggctggacggtcaccgccgtgcgactcatcaaccaggacccgtcgcgg
gaattcgagctggatcctcgctggcttcagggccgcttctacagtgccagcttcatgcac
ccgaccctgggtcgcaaggggagcgagacggccgcgaccacggtctttctggtcacccgt
cagggcggtctgcgtgacgctctggcgcgtcaggggaggtaa

DBGET integrated database retrieval system