KEGG   Halomonas elongata: HELO_4058
Entry
HELO_4058         CDS       T01311                                 

Gene name
tfc14
Definition
(GenBank) secretion cluster MPF-G protein Tfc14
Organism
hel  Halomonas elongata
SSDB
Motif
Pfam: UPF0242 TrbI COG5 FapA DUF3584 Leu_zip Spc7 Phage_GPO Fez1 APG6_N Ax_dynein_light Golgin_A5 FUSC CASP_C DUF2203 DUF4407 BshC Jnk-SapK_ap_N V_ATPase_I TMCO5 DivIC
Other DBs
NCBI-ProteinID: CBV43942
UniProt: E1VA54
Position
3583678..3585159
AA seq 493 aa
MAPLKSNGLLKVLVPGALVLVILIVVMALGGGDGDDSGGEDEATDPSLVLTDEEKTALGI
EADTPRDTVATLVGQLRQTNAEMQQMREESAQLREQNERLAERARNVDQQVAAAMREERE
RHRSQLNQQSNEQQSVLGTLKRQINQLQGQLDTSGSEDDVPVGLGLEGGGAGTSGGQLAW
VEPLDAAPTDSRGRRSNDEGPVFPTSFGEASDAVSDSATRAATAIEAKATGEPDASTVEP
VYTVPENSTLMGSLGMTALIGRVPINGTVNDPYPFKAVIGQDNLTANGIEIPELEAAVVS
GTATGDWTLSCVRGNIDSMTFVFQDGTIRTVPTPEDVNSGGGGSSRQSGDTTIGGGDSIG
WISDAYGTPCVTGERRSNAQEYLGTQSLLTAAGAGVASTLSDDDSTSFTTMGPDGSVTQA
MSGNQAVGQILTQGVNDMSNWVNQLYGQAFAAVYVPPGQEVAIHITKQLPIDFETEGRKV
HYGHSQAPTYALP
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggcaccactgaagagcaacggcttgttgaaggtcctggtccccggggcgctcgtcctg
gtcatcctgattgtcgtcatggccctgggcggtggcgacggtgacgactcgggaggtgaa
gacgaggccacggatccgtcactggtcctgaccgatgaagaaaaaaccgccctgggcatc
gaggcggacaccccgcgtgacacggtggcgaccctggtcggtcagctgcggcagaccaac
gccgaaatgcagcagatgcgggaagaaagtgcacaacttcgcgagcagaacgaacgcctc
gccgagcgcgcccgcaatgtcgaccaacaggtcgcagcggcgatgcgcgaagaacgtgaa
cgccaccgatcgcagctgaaccagcaatccaatgaacagcaatccgtgctgggcaccctg
aaacgtcagatcaaccaactgcagggccaactggatacgtcgggttccgaggacgacgtc
ccggtgggcctcgggctggaaggcggaggtgccggtaccagtggcggccaactcgcctgg
gtggagcctcttgacgccgctcctacggatagccggggacgtcggtccaatgacgaaggt
ccggtgtttccgacatcgttcggtgaggcctcggacgccgtgagcgactcggccacccgt
gccgccacagcaatcgaagccaaggccaccggggagccggatgcctcgaccgtcgaaccc
gtctacaccgtgccggagaactcgaccctgatgggttcgctgggcatgacggcgttgatc
ggccgagtaccgatcaacggcaccgtcaatgatccctatcccttcaaagccgtgattggc
caggacaatctcacggccaatggcatcgagatccccgaactggaagccgccgtggtcagt
ggtacagccacgggcgattggacgctgtcctgtgtgcgcggaaatatcgacagcatgacc
ttcgtgttccaggacggcaccatccgcaccgtccccaccccggaggacgtcaacagtggt
ggcggcggcagcagccgccagagtggtgacaccaccatcggcgggggtgactcgatcggc
tggatcagcgatgcctatggcacgccctgtgtgaccggcgaacgccgctccaacgcccag
gagtatctgggcacccagtcgttgctgaccgccgccggcgccggtgtggcctccacgctc
tccgacgatgacagcacgtccttcaccaccatgggccccgatggctccgtgacgcaggcc
atgagcggcaaccaggccgtcggccagatcctgacgcagggcgtcaatgacatgagcaac
tgggtgaaccagctgtatggccaggccttcgcggcggtgtatgtcccgccgggccaggaa
gtggccatccacatcaccaagcagctgccgatcgacttcgagaccgaagggaggaaagtc
cactatggccactctcaagcaccaacctatgccctgccgtag

DBGET integrated database retrieval system