KEGG   Halomonas elongata: HELO_4059
Entry
HELO_4059         CDS       T01311                                 

Gene name
tfc15
Definition
(GenBank) secretion cluster MPF-G protein Tfc15
Organism
hel  Halomonas elongata
SSDB
Other DBs
NCBI-ProteinID: CBV43943
UniProt: E1VA55
Position
3585146..3585610
AA seq 154 aa
MPCRRARRAGLLGLSLAIMVGLSGCATSKDELMPHGDTTMKELWQGGAASGGESLTQQGL
LDARSTLRREVSDGAMVDQRVHYTRTAANEIYNRFARLPNPDIVMYVYPHLAGGEVPVPG
YSTVFSLYRKPQYAMPGETARPSVERAQQRRAAR
NT seq 465 nt   +upstreamnt  +downstreamnt
atgccctgccgtagggcccgccgggcgggcctgttggggctcagcctggccatcatggtg
ggactgagcggctgcgccacctccaaggacgagctcatgccccatggtgacaccaccatg
aaggagctctggcaaggtggcgccgcctcgggcggcgagagcctgacccagcaggggctg
ttggatgcccgcagcacgctgcgtcgtgaggtcagtgatggcgcgatggtggatcagcgc
gtgcactacacccgtaccgccgctaacgagatctataaccggttcgcccggctgcccaat
ccggacatcgtgatgtacgtctacccgcacctcgccggcggcgaggtgccggtgccgggt
tactccacggtgttttcgctataccgcaagccgcagtacgccatgcccggcgagacggcc
cggccgtccgtcgaacgggcgcaacagcggagggcggcacgatga

DBGET integrated database retrieval system