KEGG   Halomonas elongata: HELO_4060
Entry
HELO_4060         CDS       T01311                                 

Gene name
tfc16
Definition
(GenBank) secretion cluster MPF-G VirB4-type ATPase protein
Organism
hel  Halomonas elongata
SSDB
Motif
Pfam: TraC_F_IV AAA_10 P-loop_TraG FtsK_SpoIIIE T2SSE AAA_7 AIG1 AAA_22 AAA_16 TrwB_AAD_bind AAA_29 DUF87
Other DBs
NCBI-ProteinID: CBV43944
UniProt: E1VA56
Position
3585782..3588736
AA seq 984 aa
MSAFDTFMSRLFPPRTAPAGNPLPEEDHASSAADPQDLGAAAAAPLLTDEQGRPLSLPRG
KPISEAQLRKQYQRAPSFASRLPWVEYLPESGCFLLEDGVSVGVVAEVIPIPTEGRSENA
LEALRDQIEAALQDSLPENDDYQWVAQLYCRDETDPREDLEALADYARPEIRDSQYTQDW
LKSMEGHLRAIAKPGGLFIDDVVTQVAWRGQTRRTRLVLYRWERTVKGKQQSRVGERNKG
LPPEQAVNYVFDRLETALQNAELRLKRYDAREFHRWMMPRFNPCPRYSPDDPQRFYDIFD
YPGDDQAALMGSDLAEGMLASSPRGDVETGYWYFDGMPHTCVPVEELRQAPKVGHVTGEV
ARGDGRIRNALMDQLPEGTEMCLTMVAVPQEPLEQHIDTLRDKAHGNSIASEKIRADCKR
ARSFLGDNHKLYQASLVFFINGRDESHLEDRLMRLTTQLTNANLKPTEPEDEIAGLNTYL
RWLPMCFQPELDRKNRWYTQYHFVQHLANLSPLFGRARGTGHPGITFFNRGGGTVSFDPL
NSDDRQANAHMLFFGPTGAGKSATLNSVLAQMMALHRPRLFIIEKGNSFGLLADYFERMG
LTVNKVKLAPGSGVRLSPFFEAHRLLDTEEEAKRVERDRNDQHEGLATDPDTLVNNAEEE
EERNILGEMEITARLMITGGDPKEEALFRRADQRMVRDAIYRGARYAVDAGRQCLTEDVR
QGFRDIANDPETPDEGRRRAYQMGEAMGLFVDGFDGQVFNRPGEPWPECDVTIIDLAHYA
NEGYEAQLALSVISITNVITAMAERDQYSGRPILQAIDECHILTTNPLLAPFLVGVGKMG
RKLNHWLWLATQNLEDFPESAAKLLNMIEWWILLTMPEDEIKQVTRFKSLSEDQQQLVKS
ATKVKAKYTEGVVLGGRIESLFRVVPPSLYLSLAGTEGEEKAERKQVMDEFKCSELDAGI
EIARRMDEKRGIGESQGGFDDSVS
NT seq 2955 nt   +upstreamnt  +downstreamnt
atgtcggcgtttgataccttcatgagcaggctgtttccgccgcgtaccgccccggctggc
aatcccttgccagaggaggaccacgcgtcgagcgccgccgatcctcaggacctcggcgcg
gccgccgcggcgcccttgctgaccgacgagcaggggcgtccgctgtcactgccccgtggc
aagccgatttccgaggcgcagttgagaaagcaatatcaacgcgccccttcctttgcctca
cgcttgccctgggtcgagtatctccccgagtcaggctgctttctgctcgaggacggcgtc
tcggtcggtgtcgtggccgaagtgatcccgattcctacggaaggccgcagcgagaacgcc
ctcgaggcgcttcgcgatcagatcgaggccgccctgcaggacagcttgcctgagaacgat
gactatcaatgggtcgcgcagctctattgccgcgatgagacggatccgcgcgaggacctg
gaggcgctggccgactacgcgcgtccggagatccgcgacagccaatacacccaggactgg
ctgaagagcatggaaggccatctccgggcgatcgccaagcccggcggattgttcatcgac
gatgtggtgacccaggtggcttggcggggccagacacggcgcacccgcctggtgctgtat
cgctgggagcggactgtcaaaggcaagcagcagagccgggtcggcgaacgcaacaagggg
ctgccgcccgaacaggcggtgaattatgtcttcgatcggcttgagacggccctccagaac
gccgaactgcgtctcaagcgctatgatgcccgcgagttccaccgctggatgatgccgcgc
ttcaacccatgtccccggtactcaccggacgatccgcaacgcttctacgacatcttcgat
taccccggcgatgaccaggcggccctgatgggttccgacctggccgagggcatgctggcc
agctcaccgcgcggtgatgtcgagacgggctactggtacttcgacgggatgccgcatacc
tgtgtccccgtggaggagttgcggcaggcccccaaggtgggccacgtcaccggcgaggtg
gcgcgtggcgacggtcgcatccgcaatgccctgatggaccagctccccgagggcaccgag
atgtgcctgaccatggtggcggtcccccaggagcccctggaacagcatatcgatacgctg
agggacaaggcgcacggcaacagcattgccagcgagaagatccgggcagactgcaagcgg
gcacggtcgtttctcggcgataatcacaagctgtatcaggccagcctggtgttctttatc
aacggtcgcgacgagtcccatctcgaggaccgtttgatgcggctgacgacgcagctgacc
aatgccaacctcaagccgaccgagcccgaggatgagatcgccgggctcaatacctacctg
cgctggttgcccatgtgttttcagccagagctggatcgtaagaatcgctggtacacccag
taccacttcgtacagcacctggcgaacctctcccccctgttcggtcgtgcccgcgggacg
ggccaccccggtatcaccttcttcaaccgcggcggtggcaccgtaagcttcgatccactc
aacagcgatgaccgacaggccaacgcccacatgctgttctttggcccgaccggggccggc
aagtcggccactctgaacagtgtgctggctcagatgatggctcttcaccggccacggctg
ttcatcatcgagaaggggaactcattcgggctcctcgccgattacttcgagcggatgggg
ctgaccgtcaacaaggtcaagctcgccccgggctccggtgttcggctctcgccgtttttc
gaagcgcatcgtttgctcgacaccgaggaggaagccaagcgcgtcgaacgtgaccgtaac
gatcagcatgaaggcctggcgaccgatcccgataccctggtcaacaacgccgaggaagaa
gaagagcgcaacatcctgggggaaatggagatcaccgcccggctgatgatcaccggtggc
gatcctaaagaggaagccttgttccgccgagcggatcaacgcatggtgcgggacgccatc
tatcgcggtgcccgctacgccgtcgatgccggccgtcagtgcctgaccgaggacgtacgg
caagggttccgggatatcgccaacgatcccgagacgccggacgaaggccgtcggcgcgcc
taccagatgggtgaggccatgggcctgttcgtcgacggcttcgatggccaggtcttcaac
cgcccgggtgagccctggccggaatgcgatgtgacgatcatcgacctggcgcactacgcg
aacgaaggctatgaagcgcagctcgcgctgtcggtgatctcgatcaccaacgtgatcacc
gccatggccgagcgcgaccagtacagcggtcgccccatcctgcaggccatcgatgagtgc
cacattttgaccaccaatcccttgctcgcgcccttcttggtgggcgttggcaaaatgggg
cgcaaactgaatcactggctctggttagccactcagaatttggaagatttcccggagtcg
gcggccaagctgctcaacatgatcgagtggtggatcctgctgaccatgcccgaggacgag
atcaagcaggtcactcgcttcaaatccctgagcgaggatcagcagcaactggtgaagtcc
gccaccaaggtcaaggccaagtataccgagggggtggtgctcggcggacgcatcgagtcc
ttgttccgggtcgttcctcccagtctgtatctcagcctggccggcaccgaaggcgaggaa
aaagccgagcgaaaacaggtcatggacgagttcaagtgctcagagctcgatgcgggcatc
gagattgcccgacgtatggacgagaagcgagggatcggagagtcacaggggggctttgat
gacagcgtatcttga

DBGET integrated database retrieval system