KEGG   Halomonas elongata: HELO_4067
Entry
HELO_4067         CDS       T01311                                 

Gene name
tfc24
Definition
(GenBank) secretion cluster MPF-G protein Tfc24
Organism
hel  Halomonas elongata
SSDB
Motif
Pfam: DUF1525 gpW DUF1382 YnfE
Other DBs
NCBI-ProteinID: CBV43951
UniProt: E1VA63
Position
3594322..3594750
AA seq 142 aa
MARHPTRWLIPLLSILALPAWAGVEVFTTAGQPVVNVPSDAAVVEIDAPARLDAQLSEGI
PANRDQARQEALRRLKAPDWQAKRQALKEAAMGTARAWMIGIKKVPAVVVDSRYVVYGEA
DVSQALEQIEAYQQETQQEASP
NT seq 429 nt   +upstreamnt  +downstreamnt
gtggctcgacacccgacacgctggttgattccgttgctttcgatactcgccttgccggcc
tgggccggcgtggaggtgttcacgacggccgggcagccggtcgtcaatgtgccgtccgac
gcagccgtcgtcgaaatcgatgcgccggcacggctggatgcgcagttgtcagagggcatt
cctgccaaccgtgaccaggcgcgccaggaagcgctgcgccgactgaaggcacctgattgg
caagcgaaacgtcaggccctcaaggaagcggccatgggcacagcgcgcgcctggatgatc
ggtatcaagaaggtgccggcggtcgtcgtggacagccgctacgtcgtctatggcgaagcc
gatgtcagccaggccctcgagcagattgaagcgtaccagcaagagacccaacaggaggcg
agcccatga

DBGET integrated database retrieval system