KEGG   Halomonas elongata: HELO_4068
Entry
HELO_4068         CDS       T01311                                 

Gene name
tfc23
Definition
(GenBank) secretion cluster MPF-G protein Tfc23
Organism
hel  Halomonas elongata
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-ProteinID: CBV43952
UniProt: E1VA64
Position
3595651..3596631
AA seq 326 aa
MSLIQRWQGGGLTTLLALVLSVSGVANQPVQAAEISTVEIAESALSPSCLDYRAIGICVW
LTCTAWGCYTETSIKVTHYIPELVVSSYQRTGENPWPAVRMMAPPNNLSQRGGTSTDRHS
NNHQNLRFKNVDAIGHPALATFQSDWGGFLCKSRGKPMLPYFLSTLDPAAWRSNIPESGY
PQALTPGVRELGQPGDLWGNIYPRGGFINQGNDYKAGAVAAQRVADVVTRTGQPHVYNPL
LSHHDEGYWPPDPVKEGDRSTHRWQPLAPQMEDSCAVWPDRGPMATYQDRRDGSGDNVWA
MWRPITCCARRGEELLFDTGGDGWVE
NT seq 981 nt   +upstreamnt  +downstreamnt
atgagcctgatacaacgttggcaggggggcggcctgaccaccctgctggccctggtgctg
agtgtcagtggtgtcgccaaccaaccggtgcaggcggccgagatctccaccgtcgagatc
gccgagtcagcactgtctccgtcgtgcctcgactacagggccatcggcatctgtgtgtgg
ctcacctgtacggcttggggctgctataccgaaacgtccatcaaggtcactcactatatc
ccggagctggtggtctcgagctatcagcgcaccggcgagaatccgtggccagcggtgcgc
atgatggccccgcccaacaacctgtcccagagaggcggaaccagcacggaccggcacagc
aacaaccaccagaatctgcgcttcaagaacgtggatgccatcggccatccagccctggcc
acctttcagtcggattggggcgggtttctgtgcaagtcgcgtggcaagccgatgctgccg
tacttcctgtccacgctcgacccggccgcttggcgctccaacatcccggaatccggctat
ccgcaggccctgacaccgggcgtgcgcgagctggggcagcctggcgatctgtggggcaac
atctatccacggggcgggttcatcaaccagggcaacgactacaaagccggcgctgtcgcc
gcacagcgcgtggccgacgtcgtcacgcgaaccggtcagccgcatgtctacaatccgcta
ctttcccaccacgacgagggctactggccaccggatcccgtgaaggaaggcgaccggtcg
acgcatcgctggcagcccctcgcccctcagatggaagacagctgtgccgtctggcccgat
cgcgggccgatggccacctaccaggaccggcgcgatggcagcggggataacgtctgggcg
atgtggcgaccgattacctgctgcgcgcgtcgtggcgaggaactgctctttgataccgga
ggtgacggatgggtcgaatga

DBGET integrated database retrieval system