KEGG   Halomonas elongata: HELO_4069
Entry
HELO_4069         CDS       T01311                                 

Gene name
tfc22
Definition
(GenBank) secretion cluster MPF-G protein Tfc22
Organism
hel  Halomonas elongata
SSDB
Motif
Pfam: Uds1 SlyX
Other DBs
NCBI-ProteinID: CBV43953
UniProt: E1VA65
Position
3596628..3598046
AA seq 472 aa
MTHTMTRLTLGISLAAAVSTAQAQTASDALYYDIGGAAPISVSAGRGHSPSALSMGARWN
LNATCGNFDMGASVSNQLNGITNGFQNLMGDVVQNATGAVASLPAMVIQRANPQLYDLLQ
NGVLQGRLDYDKTKLSCQNMAEQMTDFAMGEQSQQAAKAENWKATAKNTQDPVAAQEVVE
EQGGNKGRTWVGGQKRGGENQEPIEVVEDTAIAGYNQLHGRSDPTSTQSVSGGGQGWGSI
STNDGDWPGGGSFSNAASGDCQGGMCTVWQDPQEAADWTKSVIGETEIRTCDGCDKRQGQ
AGTGLMKALEEEQTTLAENLADLVSGNTDPTPSALNAVSAGPGLSVSRGVIEAIRKDPDA
ELLTQRLAGEMALSRTLTKAMWARRTLLAGASEPGIANNEEGMTELERKLTHLDRDIDAL
KSELEVRTALANNAAQLALQRVAQRRANTSAPGVNLPESRRDNRGRPSEEAN
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgacacacaccatgactcgcctgacgctgggcatcagcctggcggcggcggtcagcacc
gcacaggcgcaaaccgcctcggatgccctgtattacgatatcggcggcgccgccccgatc
agcgtctccgcggggcggggccactcgccttcggcgctcagcatgggcgccaggtggaac
ctcaacgccacctgcggcaacttcgacatgggcgcctccgtgtcgaaccagctcaacggc
attaccaacggcttccagaacctcatgggtgatgtcgtccagaacgccaccggggcggtg
gcgtcgttgcccgccatggtgatccagcgagcgaacccccagctctatgacctgctgcag
aacggtgtgctgcaggggcgcctggactatgacaagaccaagctgtcgtgccagaacatg
gccgagcagatgaccgactttgccatgggagagcagtcccaacaggctgccaaggcagag
aattggaaggctaccgccaagaacacccaggaccctgtcgctgctcaggaagtggtcgag
gaacaaggcggcaacaagggccgcacctgggtcggcggtcaaaagcgcggaggggaaaat
caagagccgatcgaggtcgtcgaggatacagcgatcgcgggttacaaccagctgcacggc
cgtagcgatcccaccagcacgcagtcagtctctggcggtggccaagggtggggatccata
tccaccaatgacggtgactggccggggggcggcagtttcagtaatgcggcctcgggtgat
tgccaggggggcatgtgcactgtctggcaggatccccaggaggccgctgactggaccaaa
tccgtgatcggtgagaccgagatccggacctgcgatggctgtgataaacgacaaggccag
gccggcaccggcctgatgaaagccctcgaggaggaacagaccaccctggccgagaatctc
gctgacctggtcagtggcaacacggaccccacgcccagcgccctgaatgcggtgtccgct
ggcccgggcctgtccgtctcacggggcgtgatcgaagcgattcgcaaagatcccgatgct
gaactgctcacgcagcgtctggccggtgaaatggcgctgtcgcgcaccctcaccaaagcc
atgtgggcacgccgcacgctcctcgccggcgccagtgagccaggcatcgccaacaatgaa
gaaggcatgaccgaactcgagcgcaagctcacgcacctcgatcgcgatatcgacgcgctc
aagagcgagctggaagtccgcaccgcgttggccaacaacgccgcccagctggccctccag
cgtgtggcgcagcgtcgggccaataccagtgccccaggcgtcaacctgcccgaatcccgt
cgcgacaaccgcggccgtccgtctgaggaggccaattaa

DBGET integrated database retrieval system