KEGG   Halomonas elongata: HELO_4071
Entry
HELO_4071         CDS       T01311                                 

Gene name
tfc19
Definition
(GenBank) secretion cluster MPF-G protein Tfc19
Organism
hel  Halomonas elongata
SSDB
Motif
Pfam: TraG_N
Other DBs
NCBI-ProteinID: CBV43955
UniProt: E1VA67
Position
3598408..3599949
AA seq 513 aa
MDVSLNVSNYMETALLMLGWVINNGIWDAMLGTGLAVIPIIALILSEWYQARREGDDEGN
KGLLTINRIEARLYAMIIIVAFTCMPVLGVSFNPVATEEIERNGETCSTAVIGDGAYSED
TLNSLDGQSAKAPLWWAFVHAVSKGMTNVAISKIPCSPDIQAVATEIDMEEIEDPILKEE
VADFTNTCFKDARSKYHEEHGEIDQDDAVDTDWLGSHEFLETSGYYDSLYAERPVKGFPF
DSDRDMSRSNTGPGQPGYPTCKEWWQDSENGLYTRLQGEISGMDQLWQALTDGTTNKDVA
TEAMVRRMVSVHGDVGKGSSSGSVNGYGARGENSAADALSKIVGGAGGAMTAGVAKVGMD
MVKQALPMIQNALVMAVVICLPFVMVVSGYSFKAAGMATFGLFAIFFLSFWWELARWMEY
HLSVMLYGDGALLVQAVVGGVENVYDRIVLTFVEWSMYFILPSVWVAALGWSGMKVGGAI
GNNLQEGSRGAKDAGESGAKQAAGKAGKAAGGK
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggacgtatcactcaacgtcagcaattacatggagaccgcgctgttgatgctcggctgg
gtcatcaacaacgggatctgggacgcgatgctcgggacgggcctggcggtgattccgatc
atcgccctgattctgtcggagtggtaccaggcacgccgagaaggtgatgacgaaggcaac
aaggggctgttgaccatcaaccgcatcgaagcccggctgtacgccatgatcatcatcgtg
gccttcacgtgcatgccggtgcttggggtgtcgttcaacccggtggccaccgaagagatc
gagcgcaatggcgagacttgcagtaccgccgtcatcggggatggggcgtatagcgaggac
accctgaattccctggatgggcagagtgccaaggccccattgtggtgggcgttcgtgcat
gccgtgtcgaagggcatgaccaatgtggccatcagcaagatcccgtgttctccggatatc
caggcggtcgccaccgaaatcgacatggaggagatcgaagaccccattctgaaggaagag
gtggcagacttcacgaatacctgtttcaaggacgcacgcagtaaatatcacgaagagcac
ggcgaaatcgatcaggatgacgccgtcgacaccgactggctcggctcccacgagttcctg
gagacgtcgggctactacgactcgctatatgccgaacggccggtcaaaggcttcccgttt
gattcggaccgggacatgtcgcgctcgaacaccggcccgggacaaccaggctatccgacc
tgcaaagagtggtggcaagacagtgaaaacggtctctacacccggctgcagggtgagatc
agtggcatggatcaactgtggcaggctctgaccgatggcacgaccaacaaggacgtggcc
accgaggccatggtccggcgcatggtgagcgtccatggcgatgtcggcaaggggagctcg
tcgggcagcgtcaacggttatggcgctcgcggtgagaacagcgcggccgacgcgctctcc
aagatcgtcggcggtgccggcggggccatgacggctggtgtggccaaggtcggcatggac
atggtcaaacaagccctgcccatgatccagaacgccctggtcatggctgtcgtgatctgc
ctgcccttcgtgatggtggtctccggatacagcttcaaagcggccggtatggcgaccttc
ggcttgtttgcgatcttcttcctgtcattctggtgggagctggcccgctggatggagtac
cacctgtcagtaatgctctatggtgacggcgcgttactggttcaggccgtcgttggcggc
gtcgagaacgtgtacgacaggatcgtgctgacgttcgtggagtggtcgatgtacttcatt
ctgccgtcagtttgggtggcggccctgggctggtcagggatgaaagttggaggtgctatt
ggtaacaatcttcaggaaggttccaggggggccaaagacgccggagagtcaggcgctaag
caagcggcaggaaaggctggtaaagcggcaggaggtaagtag

DBGET integrated database retrieval system