KEGG   Helicobacter pylori UM298: K748_00640Help
Entry
K748_00640        CDS       T02757                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hem  Helicobacter pylori UM298
Pathway
hem00071  Fatty acid degradation
hem00072  Synthesis and degradation of ketone bodies
hem00280  Valine, leucine and isoleucine degradation
hem00310  Lysine degradation
hem00362  Benzoate degradation
hem00380  Tryptophan metabolism
hem00620  Pyruvate metabolism
hem00630  Glyoxylate and dicarboxylate metabolism
hem00640  Propanoate metabolism
hem00650  Butanoate metabolism
hem00900  Terpenoid backbone biosynthesis
hem01100  Metabolic pathways
hem01110  Biosynthesis of secondary metabolites
hem01120  Microbial metabolism in diverse environments
hem01130  Biosynthesis of antibiotics
hem01200  Carbon metabolism
hem01212  Fatty acid metabolism
hem02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    K748_00640
   00630 Glyoxylate and dicarboxylate metabolism
    K748_00640
   00640 Propanoate metabolism
    K748_00640
   00650 Butanoate metabolism
    K748_00640
  09103 Lipid metabolism
   00071 Fatty acid degradation
    K748_00640
   00072 Synthesis and degradation of ketone bodies
    K748_00640
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    K748_00640
   00310 Lysine degradation
    K748_00640
   00380 Tryptophan metabolism
    K748_00640
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    K748_00640
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    K748_00640
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    K748_00640
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hem04147]
    K748_00640
Enzymes [BR:hem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     K748_00640
Exosome [BR:hem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   K748_00640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGR62060
Position
1479435..1480610
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGAVVLKDALNASGLKPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDVFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGVSIIILCSAQKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSIVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctgtggggagttttttaggctct
ctaaagagcgtgggtgctagagaaatgggtgctgtcgtgcttaaagacgctttgaatgcg
agcggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttatccgccggt
ttgggtcaaaatatcgccagacagatccaattagacgctggcatcccgaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaatatgagtgca
gcgccttatttgtcgtttgacatgcgagacgggaaaagaatggggaatgcgaacatgata
gactccatgatccatgatggattatgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgttttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcagggaaatttcaagaagaaatcacg
cccattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgtgagtattatcattttatgcagcgct
caaaaagcgcaaaaattggggttaaaaaccatggcaactatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattaaaaacaatcttaaa
aatgtcaaaatgaatctcaatgacatcaatctttttgaactcaatgaagctttcgccgcg
caaagcatagccgtattaaaagagcttgaattaaaccctaatatcgtgaatgtgaatgga
ggtgcgatagccattggccaccctattggtgcgagcggcgctaggattttagtgacttta
ttgcatgaaatgaaaagaagcggtcatggcgtgggctgcgcgtcattgtgtgtgggcggc
ggacaagggctatcaatagtagtggaacaaaaataa

DBGET integrated database retrieval system