KEGG   Helicobacter pylori UM298: K748_06485Help
Entry
K748_06485        CDS       T02757                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
hem  Helicobacter pylori UM298
Pathway
hem00330  Arginine and proline metabolism
hem01100  Metabolic pathways
hem01110  Biosynthesis of secondary metabolites
hem01130  Biosynthesis of antibiotics
hem01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hem00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    K748_06485
Enzymes [BR:hem01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     K748_06485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AGR62946
Position
complement(998785..999558)
Genome map
AA seq 257 aa AA seqDB search
MEILQFIGYGNMAQAILEGSHEILSKRFILEITGRNPEKIAPFLQEKNIQARIIPYKNAI
DIHQKFVFLLFKPYNLKDFNYQGQAKSVLSALAGVGFKALSDAINSSHYLKCMPNIASKF
ALSSTAVCEKSPMPLISQKALSVIESFGNCVRVSHEELVDASVATNGSALAFLSLVASSL
KDAGIREGLNARDSLELVKMSFKGFARLLEKERPEMIIEQICTPKGATIEGLSVLEKKGV
RGAFIKACQKSVKKMRL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcttacaattcatcggctatgggaatatggctcaagcgattttagaaggctct
catgaaattttatccaagcgttttattttagagattaccgggcgaaaccctgaaaaaatc
gccccctttttacaagaaaaaaacattcaagcacgcatcattccctataaaaacgctatt
gatatacaccaaaaattcgtgtttttactttttaagccttataaccttaaggattttaat
tatcaagggcaagctaaaagcgttttgagtgcactagctggcgtgggttttaaagcttta
agcgatgcgataaattcttcacattatctcaaatgcatgcccaatattgcgagcaagttc
gccctttcttctacggcggtgtgcgaaaaatcacccatgcccttaataagccagaaagct
ttgagtgttattgagagttttgggaattgcgtgcgagtgagccatgaagaattggtggat
gccagcgtggcgacaaacgggagtgcgcttgcgtttttaagcttggtagcgagcagtttg
aaagatgccggtattagagagggcttgaacgctagagattctttagaattggtgaaaatg
agttttaaaggttttgccaggcttttagaaaaagaacgacccgagatgattatagagcaa
atttgcacccctaaaggcgcaacgattgaaggcttgagcgttttagaaaaaaagggggtt
aggggagcgtttatcaaagcatgccaaaagagcgtgaaaaaaatgcgcctctaa

DBGET integrated database retrieval system