KEGG   Helicobacter pylori SNT49: HPSNT_00665Help
Entry
HPSNT_00665       CDS       T01916                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hen  Helicobacter pylori SNT49
Pathway
hen00260  Glycine, serine and threonine metabolism
hen00750  Vitamin B6 metabolism
hen01100  Metabolic pathways
hen01110  Biosynthesis of secondary metabolites
hen01120  Microbial metabolism in diverse environments
hen01230  Biosynthesis of amino acids
Module
hen_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hen00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSNT_00665
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPSNT_00665
Enzymes [BR:hen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPSNT_00665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AEN16310
UniProt: G2MDL7
Position
complement(133362..134822)
Genome map
AA seq 486 aa AA seqDB search
MPFVPTRSLKEKKIDFIEAILNPNAPKGGLYTLERFETLEWQDCLNLSYNELVECVFERL
GLEIPKGLLTSALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGISGDFDDAQNALKNLLKDDDFNEALKACQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTFSPAMDILKSSNVERVLFSLYGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDEACLKTIQEVYAEHQYLIDPHTATALNASLKTNEKTLVSATASYEKFP
RTTLLALNEQKKNDNDKIALETLKNSYNTPDSQHLDDLFERGIKHQEVLKLSEIKSSILL
WLESLH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccacgcgttctttgaaagaaaaaaagattgattttattgaagcaata
ttaaaccccaacgcccccaaaggcgggctttacactttagagcgttttgaaacattagaa
tggcaagattgtttgaatctgagctataacgagctggtagaatgcgtgtttgagcggttg
ggtttagagattcctaagggtttattaacaagcgctttaaaacgctatgaaaattttgat
aaccctaaaaacccggcccctatttttgcactcaatgaaaggctttttgtccaagagctc
taccatgggcctagtttggcgtttaaagacatggcgttgcagcctttagcgagcttgttt
tctaatctagcggtagggaaaaatgaaaagtatttaatgctcgtttctacaagcggcgat
accggtcctgcgactttagaaagtttggcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacgagtttagtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttgggatcagtggggattttgatgatgcacaaaacgcactcaaaaac
cttttaaaagacgatgattttaacgaggctttaaaagcgtgccaattgaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttggaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgctttaggggcgttttatgccaaaaaaatgggcttgaatatc
gctaaaatcaaggtcgtaaccaacagcaatgatgttttaagggagtttatagaaacaggg
cgttacgatttaacccaccgctctttaaagcaaactttctcgccggctatggatatttta
aaaagctctaatgtggaaagggtgctttttagcctttatgggtttgaacgcacgctagaa
ttgatgcaagctttagaagaagagaaattttacgccttaaagcctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgctcagatgaagcttgtttgaaaacaatccaa
gaagtttatgcagagcaccaatacctgattgacccccacaccgccaccgctttaaacgct
agcttgaaaaccaacgaaaaaacccttgtttctgccaccgcctcttatgaaaaattccct
agaaccacccttttagccctaaacgagcaaaagaaaaacgataacgacaaaatcgcccta
gaaacgcttaaaaacagctacaataccccggatagccagcaccttgatgatttatttgaa
agaggaatcaaacaccaagaagttttaaaactcagtgagatcaaatcttctattcttttg
tggctagaaagcctacattaa

DBGET integrated database retrieval system