KEGG   Helicobacter pylori SNT49: HPSNT_01150Help
Entry
HPSNT_01150       CDS       T01916                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hen  Helicobacter pylori SNT49
Pathway
hen00010  Glycolysis / Gluconeogenesis
hen00051  Fructose and mannose metabolism
hen01100  Metabolic pathways
hen01110  Biosynthesis of secondary metabolites
hen01120  Microbial metabolism in diverse environments
hen01130  Biosynthesis of antibiotics
hen01200  Carbon metabolism
hen01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSNT_01150 (tpiA)
   00051 Fructose and mannose metabolism
    HPSNT_01150 (tpiA)
   00562 Inositol phosphate metabolism
    HPSNT_01150 (tpiA)
Enzymes [BR:hen01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HPSNT_01150 (tpiA)
Exosome [BR:hen04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HPSNT_01150 (tpiA)
  Exosomal proteins of bladder cancer cells
   HPSNT_01150 (tpiA)
  Exosomal proteins of melanoma cells
   HPSNT_01150 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEN16405
UniProt: G2MD48
Structure
PDB: 

Position
229021..229725
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLKELEKTLKPQHFDRVFVFPDFLGLLPNSFLHFTLGVQN
AYPRDCGAFTGEITSKHLEELKIHTLLIGHSERRALLKESPSFLKEKFDFFKSKNFKIVY
CIGEELITREKGFKAVKEFLSEQLENIDLNYPNLIVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNAQNAKEILGIDSVDGLLIGSASWELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgccatggctaattttaaatccgctatgcctatttttaaaagccatgcg
tatttaaaagaattagaaaagactttaaaaccgcagcattttgatagggtgtttgtattc
cctgattttttggggttattgcctaattcgtttttgcatttcactttaggagtgcaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcacttcaaagcatttagaagaa
ctcaaaatccacacgcttttaatagggcatagcgagaggcgagcgcttttaaaggaaagc
cctagctttttgaaagaaaagtttgatttttttaaaagtaaaaattttaaaattgtttat
tgtattggcgaagaattgataaccagagaaaagggttttaaggctgtaaaggaattttta
agcgagcaattagaaaatattgatcttaattatcccaatttaattgtggcgtatgagcct
atttgggcgattggcacaaaaaagagcgcttctttagaagacatttatctcacgcatggt
tttttaaaacaaattttaaatcaaaaaacgcccttgttgtatggggggagcgtgaatgcg
caaaacgctaaagaaattttagggattgatagcgtggatggcttattgatcgggagcgcg
tcttgggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system