KEGG   Helicobacter pylori SNT49: HPSNT_03555Help
Entry
HPSNT_03555       CDS       T01916                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hen  Helicobacter pylori SNT49
Pathway
hen00071  Fatty acid degradation
hen00072  Synthesis and degradation of ketone bodies
hen00280  Valine, leucine and isoleucine degradation
hen00310  Lysine degradation
hen00362  Benzoate degradation
hen00380  Tryptophan metabolism
hen00620  Pyruvate metabolism
hen00630  Glyoxylate and dicarboxylate metabolism
hen00640  Propanoate metabolism
hen00650  Butanoate metabolism
hen00900  Terpenoid backbone biosynthesis
hen01100  Metabolic pathways
hen01110  Biosynthesis of secondary metabolites
hen01120  Microbial metabolism in diverse environments
hen01130  Biosynthesis of antibiotics
hen01200  Carbon metabolism
hen01212  Fatty acid metabolism
hen02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPSNT_03555
   00630 Glyoxylate and dicarboxylate metabolism
    HPSNT_03555
   00640 Propanoate metabolism
    HPSNT_03555
   00650 Butanoate metabolism
    HPSNT_03555
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPSNT_03555
   00072 Synthesis and degradation of ketone bodies
    HPSNT_03555
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPSNT_03555
   00310 Lysine degradation
    HPSNT_03555
   00380 Tryptophan metabolism
    HPSNT_03555
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPSNT_03555
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPSNT_03555
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPSNT_03555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hen04147]
    HPSNT_03555
Enzymes [BR:hen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPSNT_03555
Exosome [BR:hen04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPSNT_03555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEN16863
UniProt: G2MEA1
Position
733115..734290
Genome map
AA seq 391 aa AA seqDB search
MNEVVIVAAKRSAVGSFLGSLKSVGAREMGVSVLKDALNASTLKPSDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDKNAFSVNMVCGSSMKAIQLAHDAIMLGRDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDNFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAQKAQKLGLKTMATIKGFGLGGCSPDIMGVCPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSLAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKKSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttatagtggcggcaaagcgtagtgctgtagggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggcgttagcgtgctgaaagacgctttgaatgcg
agcactcttaagcctagcgatgtggattctgtcattttaggcaatgttttaggtgctggt
ttgggtcaaaatatcgccaggcagatccaattggacgctggcatccctaatgacaaaaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgat
gccatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggagaacatgagtgca
gcgccttatctgtcgtttgacatgcgagacgggaaaagaatggggaatgcgaacatgata
gactccatgatacatgatggattatgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagataatttcgcactc
caatcgcaactcaaagcaagagccgccattaatgcagggaaattccaagaagaaatcacg
cctattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gacacgactctagaatcccttgcaaaactcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcgct
caaaaagcacaaaaattggggttaaaaacaatggcaaccatcaaggggtttggtttgggt
ggttgcagtccggatataatgggtgtatgccctagcatcgctattaaaaacaaccttaaa
aatgtcaaaatgaatctcaatgacatcaatctttttgaactcaatgaagccttcgccgca
caaagcctagccgtgttaaaagagcttgaattaaaccctaatattgtgaatgtgaatgga
ggcgcaatagccattggccaccctattggcgcgagcggcgctaggatcttggtaacttta
ttgcatgaaatgaaaaaaagcggtcatggcgtgggttgtgcgtcattgtgcgtgggcggc
gggcaagggctatcagtggtagttgaacaaaaataa

DBGET integrated database retrieval system