KEGG   Helicobacter pylori SNT49: HPSNT_04445Help
Entry
HPSNT_04445       CDS       T01916                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
hen  Helicobacter pylori SNT49
Pathway
hen00540  Lipopolysaccharide biosynthesis
hen01100  Metabolic pathways
Module
hen_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:hen00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPSNT_04445
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hen01005]
    HPSNT_04445
Enzymes [BR:hen01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     HPSNT_04445
Lipopolysaccharide biosynthesis proteins [BR:hen01005]
 Unusual sugar
  HPSNT_04445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_4 KR
Motif
Other DBs
NCBI-ProteinID: AEN17039
UniProt: G2MEJ7
Position
complement(903914..904906)
Genome map
AA seq 330 aa AA seqDB search
MRYIDDELENQTILITGGAGFVGSNLAFYFQENHPKAKVIILDKFRSNTLFNNNRTSSLG
HFKNLIGFKGEVVIADINNPLDLRRLEKLHFDYLFHQAAVSDTTMLDQELVMKTNYQSFL
NLLEIARSKKAKVIYASSAGVYGNTKAPNVVGSNESPENVYGFSKLCMDEFVLSHSNDNI
QVGLRYFNVYGPREFYKEKTASMILQLALDAMAFKEVKLFEFGEQLRDFVYIEDVIQANV
KAMKAQKSGVYNVGYSQARSYNEIVSILKEHLGDFKVTYIKNPYAFFQKHTQAHIEPAIL
DLDYTPLYDLESGIKDYLPHIHAVFKEQHA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatattgatgatgagttagaaaatcaaaccattttaatcaccggtggggctggc
tttgtaggcagtaatttagccttttattttcaagagaaccaccctaaagctaaagtaatc
attttagataagtttcgcagtaacacgctctttaataataaccgcaccagttctttaggg
cattttaagaatttaatcggttttaagggtgaggtggttatagctgatattaacaacccc
ttagatttaaggcgtttagaaaaattgcattttgattatttgttccaccaagccgctgtc
tctgatacgaccatgctggatcaagaattagtgatgaaaaccaattatcagtctttttta
aaccttttagaaatcgctcgctcaaaaaaggctaaagtgatttacgcttcttcagcgggc
gtttatggcaacaccaaagcccccaatgtggtaggctcaaacgaaagccctgaaaacgtt
tatggcttttccaagctttgcatggacgaatttgtcctctcccattcaaatgacaatatt
caagtgggcttaaggtattttaatgtctatgggcctagggaattttataaggaaaaaacc
gcttctatgatcttgcaactcgccttagacgcaatggcgtttaaggaagtcaagcttttt
gaatttggcgagcaattaagggattttgtctatattgaagacgtgatccaagcgaatgtg
aaagcgatgaaggctcaaaaaagcggggtttataatgtgggttattcccaagccagaagt
tataatgaaatcgttagcattttaaaagagcatttaggggattttaaagtaacttatatc
aaaaacccttatgcttttttccaaaagcacacccaagcgcacattgaacctgctattttg
gatttagattacacccctttatacgatttagaaagcggtattaaagattatttgccccat
atccatgcggtttttaaagaacagcacgcatga

DBGET integrated database retrieval system