KEGG   Helicobacter pylori SNT49: HPSNT_05410Help
Entry
HPSNT_05410       CDS       T01916                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hen  Helicobacter pylori SNT49
Brite
Enzymes [BR:hen01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HPSNT_05410 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 NodS Peptidase_S24 Methyltransf_4 Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: AEN17217
UniProt: G2MCB0
Position
1110091..1110720
Genome map
AA seq 209 aa AA seqDB search
MNSIKNHLMCEEINKRFNLHPKVREAMESIEREVFVPAPFKHFAYTLNALSMQAQQYISS
PLTVAKMTQYLEIDQVDSVLEIGCGSGYQAAVLSQIFRRVFSIERIESLYLEARLRLKTL
GLDNVHVKFADGNKGWDQYAPYDRILFSACAKNIPQALIDQLEEGGILVAPIQENNEQVI
KRFVKQNNALHVQKVLEKCLFVPVVDGVQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagtatcaaaaaccatttgatgtgtgaagaaatcaataagcgtttcaatttgcac
cccaaagtgagagaggccatggagagcattgaaagggaggtttttgtgccagcccctttt
aaacactttgcctacactctaaacgcgctttctatgcaagcacagcaatacatttcttcg
cccctaaccgtggccaaaatgacgcaatatttagaaattgatcaagtggatagcgtgcta
gaaattggctgcgggagcggctatcaagcggcggtgctgtctcaaattttcaggcgcgtt
tttagcattgaaaggattgagagcctgtatttagaagcgcgtttgcgccttaaaactctg
ggtttagacaatgttcatgttaaattcgctgatgggaataagggctgggatcaatacgct
ccctatgataggattttgttctctgcttgcgctaaaaatatccctcaagcgcttattgat
cagcttgaagaaggcgggatattagtcgcgcccattcaagaaaataacgagcaagtgatc
aaacgctttgtgaagcaaaataacgccttgcacgtccaaaaagtgttagaaaaatgcttg
tttgtgcctgttgtagatggggtgcaataa

DBGET integrated database retrieval system