KEGG   Helicobacter pylori 26695: C694_00965Help
Entry
C694_00965        CDS       T02282                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
heo  Helicobacter pylori 26695
Pathway
heo00010  Glycolysis / Gluconeogenesis
heo00051  Fructose and mannose metabolism
heo01100  Metabolic pathways
heo01110  Biosynthesis of secondary metabolites
heo01120  Microbial metabolism in diverse environments
heo01130  Biosynthesis of antibiotics
heo01200  Carbon metabolism
heo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:heo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C694_00965 (tpiA)
   00051 Fructose and mannose metabolism
    C694_00965 (tpiA)
   00562 Inositol phosphate metabolism
    C694_00965 (tpiA)
Enzymes [BR:heo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     C694_00965 (tpiA)
Exosome [BR:heo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   C694_00965 (tpiA)
  Exosomal proteins of bladder cancer cells
   C694_00965 (tpiA)
  Exosomal proteins of melanoma cells
   C694_00965 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFV41414
UniProt: P56076
Structure
PDB: 

Position
200994..201698
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLKELEKTLKPQHFDRVFVFPDFFGLLPNSFLHFTLGVQN
AYPRDCGAFTGEITSKHLEELKIHTLLIGHSERRTLLKESPSFLKEKFDFFKSKNFKIVY
CIGEELTTREKGFKAVKEFLSEQLENIDLNYPNLVVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNTQNAKEILGIDSVDGLLIGSASWELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgccatggctaattttaaatccgctatgcctatttttaaaagccatgcg
tatttaaaagaattagaaaaaactttaaaaccgcagcattttgacagggtgtttgtattc
cctgatttttttgggttattgcctaattcgtttttgcatttcactttaggggtgcaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcacttcaaagcatttagaagaa
ctcaaaatccacacgcttttaatagggcatagcgagaggcgaacgcttttaaaagaaagc
cctagctttttgaaagaaaagtttgatttttttaaaagtaaaaattttaaaattgtctat
tgtattggcgaagaattaacgaccagagaaaagggttttaaggctgtaaaggaattttta
agcgagcaattagaaaatattgatctcaattatcctaatttagtggtggcgtatgagcct
atttgggcgattggcaccaaaaaaagcgcttctttagaagatatttatctcacgcatggt
tttttaaagcaaatcttaaatcaaaaaacgcccttgttgtatggggggagcgtgaacaca
caaaacgctaaagaaattttagggattgatagcgtggatggcttgttgatcgggagcgcg
tcttgggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system