KEGG   Helicobacter pylori 26695: C694_04480Help
Entry
C694_04480        CDS       T02282                                 

Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
heo  Helicobacter pylori 26695
Pathway
heo00380  Tryptophan metabolism
heo00630  Glyoxylate and dicarboxylate metabolism
heo01110  Biosynthesis of secondary metabolites
heo01130  Biosynthesis of antibiotics
heo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:heo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    C694_04480
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    C694_04480
Enzymes [BR:heo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     C694_04480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-ProteinID: AFV42086
UniProt: P77872
Structure
PDB: 

Position
complement(925585..927102)
Genome map
AA seq 505 aa AA seqDB search
MVNKDVKQTTAFGAPVWDDNNVITAGPRGPVLLQSTWFLEKLAAFDRERIPERVVHAKGS
GAYGTFTVTKDITKYTKAKIFSKVGKKTECFFRFSTVAGERGSADAVRDPRGFAMKYYTE
EGNWDLVGNNTPVFFIRDAIKFPDFIHTQKRDPQTNLPNHDMVWDFWSNVPESLYQVTWV
MSDRGIPKSFRHMDGFGSHTFSLINAKGERFWVKFHFHTMQGVKHLTNEEAAEVRKYDPD
SNQRDLFNAIARGDFPKWKLSIQVMPEEDAKKYRFHPFDVTKIWYLQDYPLMEVGIVELN
KNPENYFAEVEQAAFSPANVVPGIGYSPDRMLQGRLFSYGDTHRYRLGVNYPQIPVNKPR
CPFHSSSRDGYMQNGYYGSLQNYTPSSLPGYKEDKSARDPKFNLAHIEKEFEVWNWDYRA
DDSDYYTQPGDYYRSLPADEKERLHDTIGESLAHVTHKEIVDKQLEHFKKADPKYAEGVK
KALEKHQKMMKDMHGKDMHHTKKKK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggttaataaagatgtgaaacaaaccactgcttttggcgctcccgtttgggatgacaac
aatgtgattacggccggccctagaggtcctgttttattacaaagcacttggtttttggaa
aagttagcggcgtttgacagagaaagaatccctgaaagggtggtgcatgctaaaggaagc
ggagcttatggcactttcactgtgactaaagacatcactaaatacactaaagcgaaaatt
ttctctaaagtgggcaaaaaaaccgaatgcttcttcagattttctactgtggctggtgaa
agaggcagtgcggatgcggtgagagaccctagaggttttgcgatgaagtattacactgaa
gaaggtaactgggatttagtggggaacaacacgcctgttttctttatccgtgatgcgatc
aaattccctgatttcatccacactcaaaaacgagatcctcaaaccaatttgcctaaccat
gacatggtatgggatttttggagtaatgttcctgaaagcttataccaagtaacatgggtt
atgagcgataggggtattcctaaatctttccgccacatggatggttttggcagccacact
ttcagtcttatcaacgcgaaaggcgaacgcttttgggtgaaattccactttcacaccatg
caaggcgttaagcatttgactaacgaagaagccgcagaagttaggaagtatgatccggat
tccaatcaaagggatttattcaatgcgatcgctagaggggatttcccaaaatggaaatta
agcattcaagtgatgccagaagaagatgctaagaagtatcgattccatccgtttgatgta
actaaaatttggtatctccaagattatccattgatggaagtgggcattgtggagttgaat
aaaaatcctgaaaactatttcgcagaagtggaacaagcggcattcagtccggctaatgtc
gttcctggaattggctatagccctgataggatgttacaagggcgcttgttctcttatgga
gacacacaccgctaccgcttaggcgttaattatcctcaaataccggttaataaaccaaga
tgcccattccactcttctagcagagatggttacatgcaaaacggatactacggctcttta
caaaactatacgcctagctcattgcctggctataaagaagataagagcgcgagagatcct
aagttcaacttagctcatattgagaaagagtttgaagtgtggaattgggattacagagct
gatgatagcgattactacacccaaccaggtgattactaccgctcattgccagctgatgaa
aaagaaaggttgcatgacactattggagagtctttagctcatgttacccataaggaaatt
gtggataaacaattggagcatttcaagaaagctgaccccaaatacgctgagggagttaaa
aaagctcttgaaaaacaccaaaaaatgatgaaagacatgcatggaaaagacatgcaccac
acaaaaaagaaaaagtaa

DBGET integrated database retrieval system