KEGG   Helicobacter pylori 26695: C694_05430Help
Entry
C694_05430        CDS       T02282                                 

Definition
(GenBank) homoserine kinase
  KO
K00872  homoserine kinase [EC:2.7.1.39]
Organism
heo  Helicobacter pylori 26695
Pathway
heo00260  Glycine, serine and threonine metabolism
heo01100  Metabolic pathways
heo01110  Biosynthesis of secondary metabolites
heo01120  Microbial metabolism in diverse environments
heo01230  Biosynthesis of amino acids
Module
heo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:heo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C694_05430
Enzymes [BR:heo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     C694_05430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AFV42263
UniProt: O25690
Position
complement(1113035..1113916)
Genome map
AA seq 293 aa AA seqDB search
MVVSVPATSANLGPGFDCLGLSLNLRNRFFIEPSSFHAVKLVGEGEGIPKFLTNNIFTKV
FYEILKKHGNDGSFKFLLHNKVPITRGMGSSSAMIVGAVASAFAFLGFDFDRENIVNTAL
IYENHPDNITPAVFGGYNAAFVEKKKVISLKTKIPSFLKAVMVIPNRAISTKQSRHLLPK
RYSVQESVFNLSHASLMTMAIVQGKWDLLRCCSKDRMHQYKRMQTYPVLFAIQKIALENN
ALMSTLSGSGSSFFNMCYEEDAPKLKQVLSKKFPKFRVAVLDFDNDGVLIEKD
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttggtagtgagtgttcctgcaacaagtgcgaatttaggtcccggttttgattgcttgggt
ttgagtttgaatttacgcaatcggttttttattgagcctagcagtttccatgcggtgaaa
ttggttggggagggtgaagggatccctaagtttttaaccaacaatattttcactaaagtg
ttttatgagattttaaaaaagcatgggaatgacggctcgtttaaatttttattgcataat
aaagtccctattacaaggggcatggggtctagctcggcgatgattgtgggggcggtcgct
tcagcgtttgcgtttttagggtttgattttgatagagaaaacattgtcaataccgctcta
atttatgaaaaccacccggataatatcactccggcggtgtttggggggtataatgcagcg
tttgtggaaaaaaagaaagtgataagtttaaaaaccaaaatcccttcttttttaaaagcg
gtgatggtgatccctaatagggccatttccaccaagcaatcgcgccatctcttgcccaag
cgttacagcgtgcaagaaagcgtgtttaacctttcgcatgcgagtttgatgacgatggcg
attgtgcaggggaagtgggatttattgcgttgttgctctaaagacaggatgcatcaatat
aagcgcatgcaaacttaccccgtgttgtttgcgatccaaaagatcgctttagaaaataac
gccctaatgagcacgctttcagggagcggttcatcgttttttaacatgtgttatgaagaa
gacgcccctaaattaaagcaggttttgagcaagaaattccctaaatttagggtagcggtt
ttagattttgataatgatggggttcttattgagaaagactga

DBGET integrated database retrieval system