KEGG   Helicobacter pylori 26695: C694_06420
Entry
C694_06420        CDS       T02282                                 

Definition
(GenBank) hypothetical protein
  KO
K15847  outer membrane protein BabA
Organism
heo  Helicobacter pylori 26695
SSDB
Motif
Pfam: SabA_adhesion HP_OMP RmuC
Other DBs
NCBI-ProteinID: AFV42459
Position
complement(1317857..1320058)
AA seq 733 aa
MKKHILSLALGSLLVSTLSAEDDGFYTSVGYQIGEAAQMVTNTKGIQQLSDNYENLNNLL
TRYSTLNTLIKLSADPSAINAVRENLGASAKNLIGDKANSPAYQAVLLAINAAVGFWNVV
GYVTQCGGNANGQESTSSTTIFNNEPGYRSTSITCSLNGHKPGYYGPMSIENFKKLNEAY
QILQTALKNGLPALKENNGKVSVTYTYTCSGQGNNNCSPSVNGTKTTTQTIDGKSVTTTI
SSKVVGSIASGNTSHVITNKLDGVPDSAQALLAQASTLINTINEACPYFHATNSSEANAP
KFSTTTGKICGAFSEEISAIQKMITDAQELVNQTSVINSNEQSTPVGNNNGKPFNPFTDA
SFAQGMLANASAQAKMLNLAHQVGQAINPENLSENFKNFVTGFLATCNNKSTAGTGGTQG
SAPGTVTTQTFASGCAYVEQTLTNLGNSIAHFGTQEQQIQQAENIADTLVNFKSRYSELG
NTYNSITTALSKVPNAQSLQNVVSKKNNPYSPQGIETNYYLNQNSYNQIQTINQELGRNP
FRKVGIVNSQTNNGAMNGIGIQVGYKQFFGQKRKWGARYYGFFDYNHAFIKSSFFNSASD
VWTYGFGADALYNFINDKATNFLGKNNKLSLGLFGGIALAGTSWLNSEYVNLATVNNVYN
AKMNVANFQFLFNMGVRMNLARSKKKGSDHAAQHGIELGLKIPTINTNYYSFMGAELKYR
RLYSVYLNYVFAY
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgaaaaaacacatcctttcattagctttaggctcgcttttagtttccactttgagcgct
gaagacgacggcttttacacaagcgtaggctatcagatcggtgaagccgctcaaatggta
acaaacaccaaaggcatccaacagctttcagacaattatgaaaatttgaacaacctttta
acgagatacagcaccctaaacacccttatcaaattgtccgctgatccgagcgcaattaat
gcggtgcgggaaaatctgggcgcgagcgcgaagaatttgatcggcgataaagccaactcc
cccgcctatcaagccgtgcttttagcgatcaacgcggcggtagggttttggaatgtcgtg
ggctatgtgacgcaatgtgggggtaacgccaatggtcaagaaagcacctcttcaaccacc
atcttcaacaacgagccagggtatcgatccacttccatcacttgttctttgaacgggcat
aagcctggatactatggccctatgagcattgagaattttaaaaagcttaacgaagcctat
cagatcctccaaacggctttaaaaaacggcttacccgcgctcaaagaaaacaacgggaag
gtcagtgtaacctatacctacacatgctcagggcaagggaataataactgctcgccaagt
gtcaacggaaccaaaaccacaacccaaaccatagacggcaaaagcgtaaccaccacgatc
agttcaaaagtggttggtagcatcgctagtggcaacacatcacatgtcatcaccaacaaa
ttagacggtgtgcctgatagcgctcaagcgctcttagcgcaagcgagcacgctcatcaac
accatcaacgaagcatgcccgtatttccatgctactaatagtagtgaggctaacgcccca
aaattctctactactactgggaaaatatgcggcgctttttcagaagaaatcagcgcgatc
caaaagatgatcacggacgcgcaagagctagttaatcaaacgagcgtcattaacagcaac
gaacaatcaactccggtaggcaataataatggcaagcctttcaaccctttcacggacgca
agttttgcgcaaggcatgctcgctaacgctagcgcgcaagctaaaatgctcaatttagcc
catcaggtggggcaagccattaacccagagaatcttagcgagaattttaaaaattttgtt
acaggctttttagccacatgcaataacaaatcaacagctggcactggtggcacacaaggt
tcagctccaggcacagtgaccactcaaactttcgcttctggttgcgcgtatgtggagcaa
accctaacgaacttaggcaacagcatcgctcactttggcactcaagagcagcagatacag
caagccgaaaacatcgctgacactctagtgaatttcaaatctagatacagcgaattaggc
aacacctataacagcatcaccaccgcgctctccaaagtccctaacgcgcaaagcttgcaa
aacgtggtgagcaaaaagaataacccctatagccctcaaggcatagagaccaattactac
ctcaatcaaaattcttacaaccaaatccaaaccatcaaccaagaactagggcgtaacccc
tttaggaaagtgggcatcgtcaattctcaaaccaacaatggtgccatgaatgggatcggt
attcaggtgggctataagcaattctttggccaaaaaagaaaatggggcgctaggtattac
ggcttttttgattacaaccatgcgttcatcaaatccagctttttcaactcggcttctgac
gtgtggacttatggttttggagcggacgcgctttataacttcatcaacgataaagccacc
aatttcttaggcaaaaacaacaagctttctttggggctttttggcgggattgcgttagcg
ggcacttcatggctcaattctgagtacgtgaatttagccaccgtgaataacgtctataac
gctaaaatgaatgtggcgaatttccaattcttattcaatatgggagtgaggatgaattta
gccagatccaagaaaaaaggcagcgatcatgcagctcagcatgggattgagttagggctt
aaaatccccaccatcaacacgaactattattcctttatgggggctgaactcaaatacaga
aggctctatagcgtgtatttgaactatgtgttcgcttactaa

DBGET integrated database retrieval system