KEGG   Helicobacter pylori 26695: C694_06905Help
Entry
C694_06905        CDS       T02282                                 

Definition
(GenBank) nickel responsive regulator
  KO
K07722  CopG family transcriptional regulator, nickel-responsive regulator
Organism
heo  Helicobacter pylori 26695
Brite
KEGG Orthology (KO) [BR:heo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:heo03000]
    C694_06905
Transcription factors [BR:heo03000]
 Prokaryotic Type
  Ribbon-helix-helix
   CopG family
    C694_06905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NikR_C RHH_1 RHH_8 FAM219A
Motif
Other DBs
NCBI-ProteinID: AFV42556
UniProt: O25896
Structure
PDB: 

Position
complement(1398346..1398792)
Genome map
AA seq 148 aa AA seqDB search
MDTPNKDDSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWAEDNPN
DESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEI
QRLQLEIGGLRGVKFAKLTKASSFEYNE
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggatacacccaataaagacgattcaatcatccgcttttcggtttctttacaacaaaat
ttattagacgaattagacaaccgcatcattaaaaacggctattcttctcgatcagaatta
gtgcgcgacatgatcagagaaaaattagtagaagacaattgggcagaagacaaccctaat
gacgagagcaaaatcgccgtgcttgtggtgatttatgatcaccaccaaagggaattaaac
cagcgcatgatagacattcagcatgccagcgggacgcatgttttatgcaccacgcacatt
cacatggatgagcataattgcttggagacgattattttacaaggcaattcgtttgaaatc
caacgcttgcaattggaaattggggggcttaggggggttaaattcgctaaattgactaag
gcgtctagctttgaatacaatgaatag

DBGET integrated database retrieval system