KEGG   Helicobacter pylori 26695: C694_07725Help
Entry
C694_07725        CDS       T02282                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
heo  Helicobacter pylori 26695
Brite
KEGG Orthology (KO) [BR:heo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    C694_07725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 RnlB_antitoxin NnrS DUF1240
Motif
Other DBs
NCBI-ProteinID: AFV42714
UniProt: O26024
Position
complement(1564544..1566145)
Genome map
AA seq 533 aa AA seqDB search
MEIKNIKEFEKASKKLQKDTLKIALALLFLIGAALLALIFGQANSKGLLLIFAAVIGGYM
AMNIGANDVSNNVGPAVGSKAISMGGAILIAAICEMLGAIIAGGEVVSTIKGRIVSPEFI
NDAHIFINVMLASLLSGALWLHVATLIGAPVSTSHSVVGGIMGAGMAAAGMVAVNWHFLS
GIVASWVISPLMGALIAMFFLMLIKKTIAYKEDKKSAALKVVPYLVALMSLTFSWYLIVK
VLKRLYALNFEIQLACGCILALLIFILFKRFVLKKAPQLENSHESINELFNVPLIFAAAL
LSFAHGANDVANAIGPLAAISQTLEDANSPIGNTLSSVPLWIMVVGAAGIALGLSLYGPK
LIKTVGSEITELDKMQAFCIALSAVITVLLASQLGLPVSSTHIVVGAVFGVGFLRERLRE
QSRRRFARIRDNIVAAHFGEDLEEIEGFLERFDKANLKEKSLMLESLKKSKNTAIALELK
KKEKKSLKKVYKEEVIKRSILKKIVTAWLVTVPVSALLGALLFVALGFIEKYF
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaaacatcaaagagtttgaaaaagcttccaaaaaactccaaaaagacact
ttaaagatcgctctcgctcttttgtttctcatcggtgccgctttactcgctctcattttt
gggcaggctaattctaagggattgttgcttatttttgcggccgtgattggggggtatatg
gcgatgaatattggcgcgaatgatgtgtctaataatgtcggccctgccgtaggctctaaa
gccattagcatgggcggggcgattttgatcgctgcgatttgcgaaatgcttggagcgatc
attgctgggggggaagtggtttctacgattaagggccgtatcgtttcgcctgaatttatt
aatgatgcgcacattttcattaatgtcatgttggctagcttactcagtggggcgttgtgg
ttgcatgtagcgactttaattggcgctcccgtttccacttcacactctgtggtggggggg
attatgggggctggaatggcagcagctggaatggtagctgtcaattggcattttttatcc
ggtattgtggccagttgggtaatttcgcctttaatgggggctttgatagccatgtttttt
ttaatgctcattaaaaagactatcgcttataaagaagataaaaagagtgcggctttaaag
gtcgtgccttatttggtagcgttgatgagcttaacattcagctggtatttgattgttaag
gttttaaaacgcctctatgcattgaattttgaaatccagttggcttgtggctgtatcctt
gcgcttttaatctttatcctttttaaaagatttgtgttaaagaaagccccgcaattagaa
aacagccatgaaagcattaatgagcttttcaatgtccctttgatttttgccgctgcactt
ttaagctttgcgcatggggctaatgatgtggctaacgctataggccccttagccgcaatc
agtcaaactttagaagatgcaaatagccctatagggaatactttaagctctgtgccgttg
tggattatggtagtaggggcggctgggattgctttaggcttgagtttgtatgggccaaag
ctcattaaaacggtggggtcagaaatcacagaattagacaagatgcaagctttttgcatc
gcgctttcagcagtcatcaccgtgcttttagcctctcaattaggcttgcccgtaagctct
acgcatattgtggtgggcgcggtgtttggggtgggctttttaagggagcgcttaagagag
caatcaagaaggcgttttgctagaatcagagacaacattgtagccgcgcactttggggaa
gatttagaagaaattgaaggctttttagagcgctttgataaagccaatttgaaagaaaaa
tcgctcatgctagagagcttaaaaaaaagcaagaacaccgccatcgctttggaattgaaa
aagaaagaaaaaaagtcgcttaaaaaagtgtataaagaagaagtgatcaaacgctccatt
ttaaaaaagattgttaccgcttggttggtaaccgtgccggtttctgcgcttttgggggcg
cttctgtttgtggctcttggttttatagaaaagtatttctag

DBGET integrated database retrieval system