KEGG   Helicobacter pylori 26695: C694_08025
Entry
C694_08025        CDS       T02282                                 

Gene name
secF
Definition
(GenBank) preprotein translocase subunit SecF
  KO
K03074  preprotein translocase subunit SecF
Organism
heo  Helicobacter pylori 26695
Pathway
heo03060  Protein export
heo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:heo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    C694_08025 (secF)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    C694_08025 (secF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:heo02044]
    C694_08025 (secF)
Secretion system [BR:heo02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   C694_08025 (secF)
SSDB
Motif
Pfam: SecD_SecF Sec_GG ACR_tran
Other DBs
NCBI-ProteinID: AFV42772
Position
complement(1628298..1629269)
AA seq 323 aa
MELFKRTRILSFMRYSNYGVIVSAILALLALGLLFFKGFSLGIDFAGGSLVQVRYTQNAP
IKEVRDLFEKEARFKGVQVSEFGSKEEILIKFPFVETAENEDLNAIVANILKPSGDFEIR
KFDTVGPRVGSELKEKGILSLILALIAIMVYVSFRYEWRFALASVIALVHDVILVASSVI
VFKIDMNLEVIAALLTLIGYSINDTIIIFDRIREEMLSQKTKNATQAIDEAISSTLTRTL
LTSLTVFFVVLILCVFGSKIIIGFSLPMLIGTIVGTYSSIFIAPKVALLLGFDMDKYYEN
ETRKIKKAQEKEKMRRLYESGQV
NT seq 972 nt   +upstreamnt  +downstreamnt
atggaattattcaaacgaactagaatcttaagcttcatgcgttattccaattatggggtg
atcgtttcagcaattttagcgcttctagcgttggggcttttgtttttcaaagggttttct
ttagggattgattttgcgggggggagtttggtgcaagtgcgctacactcaaaacgccccc
attaaagaagtgcgcgatctgtttgaaaaagaagctcgcttcaaaggcgtgcaagtgagc
gaatttggctctaaagaagaaattttaatcaaattcccttttgtagaaacggctgaaaat
gaagatctgaacgctatcgtggccaacattctaaaacccagcggcgattttgaaatccgt
aaatttgacaccgtgggccctagagtggggagcgaattgaaagagaaaggcattttgtcg
ctgattttagcattaatagcgatcatggtttatgtgagtttccgctatgaatggcgtttt
gctttagcgagcgtcattgcgcttgtgcatgatgtgattttagtggcaagctcggtgatt
gtttttaagattgatatgaatttggaagtgattgcggccttgctcaccttgattgggtat
tccattaatgatacgatcattatttttgacaggatcagagaagagatgctctctcaaaaa
accaaaaacgccactcaagccattgatgaagccatttctagcacgctcacgcgcacgctt
ttaacttctttaaccgtgttttttgtggtgttgattttgtgcgtgtttgggagtaagatc
atcattggcttttcattgcccatgttaataggcacgattgtagggacttatagctctatt
ttcatcgcccctaaagtggcgttattgttaggctttgatatggataaatattatgagaat
gagactagaaaaattaaaaaagctcaagagaaagaaaaaatgcgccgtttgtatgagagc
ggtcaagtttaa

DBGET integrated database retrieval system