KEGG   Helicobacter pylori Puno120: HPPN120_00435Help
Entry
HPPN120_00435     CDS       T01919                                 

Definition
(GenBank) Malate:quinone oxidoreductase (Malate dehydrogenase [acceptor]) (MQO)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
hep  Helicobacter pylori Puno120
Pathway
hep00020  Citrate cycle (TCA cycle)
hep00620  Pyruvate metabolism
hep01100  Metabolic pathways
hep01110  Biosynthesis of secondary metabolites
hep01120  Microbial metabolism in diverse environments
hep01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HPPN120_00435
   00620 Pyruvate metabolism
    HPPN120_00435
Enzymes [BR:hep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     HPPN120_00435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 NAD_binding_8 Pyr_redox_3 Pyr_redox Lycopene_cycl FAD_binding_2 Thi4 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AEN14737
UniProt: G2M2U1
Position
complement(81855..83207)
Genome map
AA seq 450 aa AA seqDB search
MSMEFDAVIIGGGVSGCATFYTLSEYSSLKRVAIVEKCSKLAQISSSAKANSQTIHDGSI
ETNYTPEKAKKVRLSAYKTRQYALNKGLQNEVIFETQKMAIGVGDEECEFMKKRYESFKE
IFVGLEEFDKQKIKELEPNVILGANGIDRHENIIGHGYQKDWSTMNFAKLSENFVEEALK
LKPNNQVFLNFKVKKIEKRNDTYAVISEDIEEVYAKFVLVNAGSYALPLAQSMGYGLDLG
CLPVAGSFYFVPDLLRGKVYTVQNPKLPFAAVHGDPDAVIKGKTRIGPTALTMPKLERNK
CWLKGISLELLKMDLNKDVFKIAFDLMSDKEIRNYVFKNMVFELPIIGKRKFLKDAQKII
PSLSLEDLEYAHGFGEVRPQVLDKTKRKLELGEKKICTHKGITFNMTPSPGATSCLQNAL
VDSQEIAAYLGESFELERFYKDLSPEELEN
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggaatttgatgctgtcattattggaggtggggtttcagggtgcgcgaccttt
tatactttgagcgaatacagctctttaaagcgcgtggctatcgtggaaaaatgctctaaa
ttagctcaaatcagctccagcgctaaggctaattctcaaaccattcatgatggctctatt
gaaacgaattacactcccgaaaaagctaaaaaagtgcgtttgagcgcttataagaccagg
caatacgcgctcaataaaggcttgcaaaatgaagtgatttttgaaacccagaaaatggct
ataggcgtgggcgatgaagaatgcgagttcatgaaaaaacgctacgaatcctttaaagaa
atctttgtggggttagaagaatttgacaaacaaaagattaaagaattagagcctaatgtg
attttaggggctaatggcatagataggcatgaaaacattattgggcatgggtatcaaaaa
gattggagcaccatgaattttgcgaagttgagtgaaaacttcgttgaagaagccctaaaa
ttaaagcctaacaaccaggtgtttttgaatttcaaagtgaaaaagattgaaaaacgcaac
gacacttacgccgtaatttcagaagacattgaagaagtgtatgctaaattcgtgctggtc
aatgccggctcttacgctttgcctttggctcagagcatgggttatggcttggatttaggg
tgcttgcctgtggcgggcagcttttattttgtgccggatttattaaggggtaaggtttat
accgttcaaaaccccaaactcccttttgcagccgtgcatggcgaccctgatgccgtcatt
aaaggaaaaacacgaatcgggcctaccgctttaacgatgcctaaattagaacgaaacaaa
tgctggcttaagggcattagcttggaattgttgaaaatggatttgaataaagatgtgttt
aagattgcgtttgatttgatgagcgataaagaaatccgtaattatgtgtttaaaaacatg
gtttttgaattgcccattatcggcaaaaggaaatttttaaaagacgctcaaaaaatcatc
ccctctcttagtctagaagatttagaatacgctcatggttttggcgaagtgcgcccgcaa
gttttagacaaaaccaagcgaaagctggaattaggcgaaaaaaagatttgcacccataaa
ggcatcacttttaacatgaccccttctccaggtgcgacgagttgcttgcaaaacgctctt
gtggattctcaagaaatcgctgcgtatttgggcgagagctttgaattagaacgcttttat
aaagatttatccccagaagaattggaaaattaa

DBGET integrated database retrieval system