KEGG   Helicobacter pylori Puno120: HPPN120_03270Help
Entry
HPPN120_03270     CDS       T01919                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hep  Helicobacter pylori Puno120
Pathway
hep00071  Fatty acid degradation
hep00072  Synthesis and degradation of ketone bodies
hep00280  Valine, leucine and isoleucine degradation
hep00310  Lysine degradation
hep00362  Benzoate degradation
hep00380  Tryptophan metabolism
hep00620  Pyruvate metabolism
hep00630  Glyoxylate and dicarboxylate metabolism
hep00640  Propanoate metabolism
hep00650  Butanoate metabolism
hep00900  Terpenoid backbone biosynthesis
hep01100  Metabolic pathways
hep01110  Biosynthesis of secondary metabolites
hep01120  Microbial metabolism in diverse environments
hep01130  Biosynthesis of antibiotics
hep01200  Carbon metabolism
hep01212  Fatty acid metabolism
hep02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hep00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPPN120_03270
   00630 Glyoxylate and dicarboxylate metabolism
    HPPN120_03270
   00640 Propanoate metabolism
    HPPN120_03270
   00650 Butanoate metabolism
    HPPN120_03270
  Lipid metabolism
   00071 Fatty acid degradation
    HPPN120_03270
   00072 Synthesis and degradation of ketone bodies
    HPPN120_03270
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPPN120_03270
   00310 Lysine degradation
    HPPN120_03270
   00380 Tryptophan metabolism
    HPPN120_03270
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPPN120_03270
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPPN120_03270
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HPPN120_03270
Enzymes [BR:hep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPPN120_03270
Exosome [BR:hep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPPN120_03270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEN15273
UniProt: G2M5N7
Position
complement(661342..662517)
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGAVVLKDALNASGLKPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMICDGLWDAFNDYHMGITADNVAQAYHISREDQDAFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSTQKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKKNLK
NVKMNLNDINLFELNEAFAAQSVAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSAQSVGCASLCVGGGQGLSVIVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgcagtggggagttttttaggttct
ctaaagagcgtgggcgctagagaaatgggtgctgtcgtgcttaaggacgctttgaatgcg
agcggtcttaagcctagtgatgtggattctgtcattttaggcaatgttttatccgccggt
ttgggtcaaaatatcgccagacagatccaactggatgcgggcataccgaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaacatgagtgca
gcgccttatttgtcgtttgacatgcgagatgggaaaagaatggggaatgcgaacatgata
gactccatgatctgtgacggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagatcaagatgctttcgcgctc
caatcgcaactcaaagcaagagccgccatcaatgcagggaaattccaagaagaaatcacg
cccattgaaatagcgaataaaaaaggtgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggtgcaagcattatcattttatgcagcact
caaaaagcgcaaaaattggggttaaaaacaatggcaactatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattaagaagaatcttaaa
aatgtcaaaatgaatctcaacgacatcaatctttttgaactcaatgaagccttcgccgcg
caaagcgtagccgtgttaaaagagcttgaattaaaccctaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggcgcaagcggcgctaggatcttagtaacttta
ttgcatgaaatgaaaagaagcgctcaaagcgtgggctgcgcgtcattgtgtgtgggcggc
ggtcaagggctatcagtaatagtggaacaaaaataa

DBGET integrated database retrieval system