KEGG   Helicobacter pylori Puno120: HPPN120_04245Help
Entry
HPPN120_04245     CDS       T01919                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
hep  Helicobacter pylori Puno120
Pathway
hep00540  Lipopolysaccharide biosynthesis
hep01100  Metabolic pathways
Module
hep_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:hep00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPPN120_04245
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hep01005]
    HPPN120_04245
Enzymes [BR:hep01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     HPPN120_04245
Lipopolysaccharide biosynthesis proteins [BR:hep01005]
 Unusual sugar
  HPPN120_04245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 KR
Motif
Other DBs
NCBI-ProteinID: AEN15464
UniProt: G2M4V1
Structure
PDB: 

Position
complement(853510..854502)
Genome map
AA seq 330 aa AA seqDB search
MRYIDDELENQTILITGGAGFVGSNLAFYFQENHPKAKVVVLDKFRSNTLFSNKRPSSLG
HFKNLIGFKGEVVIADINNPLDLRRLEKLHFDYLFHQAAVSDTTMLDQELVMKTNYQAFL
NLLEIARQKKAKVIYASSAGVYGNTKAPNVVGKNESPENVYGFSKLCMDEFVLSHSNDNI
QVGLRYFNVYGPREFYKEKTASMVLQLALGIMAFKEVKLFEFGEQLRDFVYIEDVIQANV
KAMKAQKSGVYNVGYSQARSYNEIVSILKEHLGDFKVTYIKNPYAFFQNHTQAHIEPTIL
DLDYTPLYDLESGIKDYLPHIHAIFKEQHA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatattgatgatgagttagaaaatcaaacgattttaatcaccggtggggctggc
tttgtaggcagtaatttggccttttattttcaagagaaccaccctaaagctaaagtggtg
gttttggataaatttcgcagtaacacgcttttcagtaataagcgccccagttccttaggg
cattttaagaatttaatcggttttaagggtgaggtggttatagctgatattaataacccc
ttagatttaaggcgtttagaaaaattgcattttgattatttgttccaccaagctgctgtc
tctgatacgaccatgctggatcaagaattagtgatgaaaaccaactaccaggctttttta
aaccttttagaaatcgctcgccaaaaaaaagctaaagtgatttacgcttcttcagcgggc
gtttatggcaacaccaaagcccccaatgtggtaggcaaaaacgaaagccctgaaaacgtt
tatggcttttccaagctttgcatggacgaatttgtcctctcccattcaaatgacaatatt
caagtgggcttaaggtattttaatgtctatgggcctagggaattctataaagaaaaaacc
gcttctatggttttgcaactcgccttaggcataatggcgtttaaggaagtcaagcttttt
gaatttggcgagcaattaagggattttgtctatattgaagatgtgattcaagcgaatgtg
aaagcgatgaaggctcaaaaaagcggggtttataatgtgggttattcccaagccagaagt
tataatgaaatagttagcattttaaaagagcatttaggggattttaaagtaacttatatc
aaaaacccttatgctttcttccaaaatcacacccaagcgcatattgaacccactattttg
gatttagactacacccctttatacgatttagaaagcggtattaaagattatttgccccat
atccatgcgatttttaaagaacagcatgcatga

DBGET integrated database retrieval system