KEGG   Helicobacter pylori Puno120: HPPN120_04375Help
Entry
HPPN120_04375     CDS       T01919                                 

Gene name
cysS
Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
hep  Helicobacter pylori Puno120
Pathway
hep00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:hep00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HPPN120_04375 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hep01007]
    HPPN120_04375 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hep03016]
    HPPN120_04375 (cysS)
Enzymes [BR:hep01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     HPPN120_04375 (cysS)
Amino acid related enzymes [BR:hep01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   HPPN120_04375 (cysS)
Transfer RNA biogenesis [BR:hep03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    HPPN120_04375 (cysS)
 Prokaryotic Type
    HPPN120_04375 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1 tRNA-synt_1d tRNA-synt_1f tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AEN15490
UniProt: G2M4X7
Position
879641..881038
Genome map
AA seq 465 aa AA seqDB search
MFIYDTKLKQKVPFEPLVEKKANIYVCGPTVYDDAHLGHARSAIAFDLLRRTLELSGYEV
VLVRNFTDIDDKIINKALKENKSIQELSSIYIESYTRDLNALNVKKPSLEPKASEYLDAM
VGMIETLLEKNIAYQISNGDIYLDTSKDKDYGSLSVHNSSIEFGRIGLVQEKRLEQDFVL
WKSYKGDNDVGFDSPLGKGRPGWHIECSSMIFKTLALTDTPYQIDIHAGGADLLFPHHEN
EACQTRCAFGVELAKYWMHNGFVNINNEKMSKSLGNSFFIKDALKNYDGEILRNYLLGVH
YRSVLNFNEEDLLVSKKRLDKIYRLKQRVLGTLGGINPNFKREILECMQDDLNVSKALSV
LESMLSSTNEKLDQNPKNKALKGEILANLKFVEELLGIGFKDPVEYFQLGVSESEKQEIE
NKIEERKRAKEQKDFLKADNIREELLNHKIALMDTPQGTIWEKFF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtttatttatgataccaaattaaaacaaaaagtcccttttgagcctttagttgaaaaa
aaggcgaatatttatgtgtgcgggcctacggtgtatgatgacgctcatttagggcatgct
aggagcgcgattgcttttgatttgttaaggcgcacgcttgaattgagcggctatgaagtg
gtgctggtaaggaatttcaccgatattgatgataaaatcatcaacaaagccctaaaagaa
aacaaaagtattcaagaattaagcagcatttatattgaatcttacacgagggatttaaac
gctttgaacgtgaaaaaacctagcctagagcctaaagcgagcgagtatttagacgctatg
gtgggcatgattgaaacgcttttagaaaaaaatatcgcttatcagatctctaatggggat
atttatttagacacgagcaaggataaagattacggctctttgagcgtgcataatagcagt
attgaatttggccgtattggtttggtgcaagaaaaacggcttgagcaggattttgtgtta
tggaaaagctataagggggataatgatgtgggctttgatagccctttaggcaaagggcgc
cctggctggcatatagaatgctctagcatgatctttaaaactttagcgctcactgacacc
ccctatcaaattgacatccatgcaggcggagcggatttgttattccctcaccatgaaaat
gaagcgtgccaaacccgttgcgcctttggcgtggagcttgccaaatactggatgcataat
ggctttgtgaatatcaataacgaaaaaatgtctaaaagtttagggaatagcttttttatt
aaagacgccctcaaaaactatgatggcgaaattttgcgcaattacttactaggggtgcat
tatcgctctgttttgaatttcaatgaagaagacttattggtgagtaaaaaacgcttggat
aaaatctatcgtttaaaacagcgcgttttagggactcttggaggaataaatccaaacttt
aaaagagaaattttagaatgcatgcaagatgatttaaacgtttctaaagcgttgagcgtt
ttagaaagcatgctttcttctactaatgaaaaactggatcaaaaccccaaaaacaaggct
ttgaaaggcgaaattttagcgaatttgaaatttgtagaagaactgcttggcatcgggttt
aaagaccctgtagaatatttccaattaggcgtgagtgaaagcgaaaaacaagaaattgaa
aacaagatagaagaaagaaaacgcgccaaagagcaaaaagattttttaaaagccgataac
atcagagaagagcttttaaaccacaaaatcgctttgatggacaccccacaaggcacgatt
tgggagaagtttttttaa

DBGET integrated database retrieval system