KEGG   Helicobacter pylori Puno120: HPPN120_07045Help
Entry
HPPN120_07045     CDS       T01919                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hep  Helicobacter pylori Puno120
Pathway
hep00900  Terpenoid backbone biosynthesis
hep01100  Metabolic pathways
hep01110  Biosynthesis of secondary metabolites
hep01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hep00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPPN120_07045
Enzymes [BR:hep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HPPN120_07045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AEN15990
UniProt: G2M4E8
Position
1418738..1419541
Genome map
AA seq 267 aa AA seqDB search
MHAFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDRFKDIISVKSALSFSLKGDFDCPLE
ENSLFKALQILKNFLKSKNFSHSAIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHLN
QIFDWRLSSEELYNMGSLVGADTNFFISQHKSANATSYGEVIENFEEEPLENRLEIYTPN
HVFCSTKAIYQAYKPETCFSQAKEWLKKPSLECLKTCDRNELNDLLKPALLTNQALRGIE
SELGKEWFFSGSGSAFFRLKPALKEGE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcctttgaagtttatcctaaagtcaatatttttttaaaaatccttcacaaagaa
ggggcttatcataagctcatttctcgcatgtgtttggtcaaagatagattcaaagatatt
atcagcgtcaaaagcgcgctttccttttcattaaaaggggattttgactgccctttagaa
gaaaactcgctctttaaagccctccaaattttaaaaaattttttaaaatcaaaaaatttc
tctcattctgccatcaaatccctagacaccctagcgattgaagtggaaaaaaacatcccc
actcaagccggattaggcggtgggagcgctgatgctggggggctattgtatcatttgaat
caaatttttgactggcgtttgagttcagaagagctttataacatgggatctttagtgggt
gcagacaccaactttttcatctcgcaacacaaaagcgctaacgccacttcttatggcgaa
gttattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatacgccaaac
catgttttttgcagcactaaagccatttatcaagcctataagcctgaaacttgtttttct
caagctaaagagtggcttaaaaagccgagtttagaatgcctaaagacttgcgacaggaac
gaattaaacgatcttttaaaaccggctttactcactaaccaagccttaagaggcatagaa
agtgaactgggcaaggagtggttttttagcgggagtgggagcgcgttttttaggctaaag
cctgcgttaaaagagggcgaatga

DBGET integrated database retrieval system