KEGG   Helicobacter pylori F32: HPF32_0401Help
Entry
HPF32_0401        CDS       T01911                                 

Definition
(GenBank) hypothetical protein
  KO
K07164  uncharacterized protein
Organism
heq  Helicobacter pylori F32
Brite
KEGG Orthology (KO) [BR:heq00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    HPF32_0401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-RING_7 zf-ribbon_3 DNA_RNApol_7kD
Motif
Other DBs
NCBI-ProteinID: BAJ57983
UniProt: E6NNQ7
Structure
PDB: 

Position
419612..420364
Genome map
AA seq 250 aa AA seqDB search
MNTHLKQLIEISHLDKEIDSLEPLIREKRKDLDKALNDKEAKNKAILNLEEEKLALKLQV
SKNEQTLQDANAKIASIQKKMSEIKSERELRSLNIEEDIAKERSNQANREIENLQNEIKH
KSEKQEDLKKEMLELEKLALELESLVENEVKNIKETQQIIFKKKEDLVEKTEPKIYSFYE
RIRRWAKNTSIVTIKKQACGGCFIRLNDKIYTEVLTSGDMITCPYCGRILYAESAYENSA
QPPKESQELV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaacacccacctcaaacaattgattgaaatttcgcatttggataaagaaattgactcc
ttagagccattgatcagagaaaaacggaaagacttggataaagccttgaatgataaagaa
gctaaaaataaagcgattttgaatttagaagaggaaaaattagccctaaaattacaggtt
tctaaaaacgagcaaaccttacaagacgcgaacgctaaaatcgccagtatccaaaaaaaa
atgagcgagatcaaatccgaaagggaattgcgctctttaaacattgaagaagatattgct
aaagagcgatccaaccaggccaacagagaaattgaaaacctgcaaaatgaaatcaagcac
aaaagcgaaaaacaagaggatttgaaaaaagaaatgctagagcttgaaaaattagcgctg
gaattggaaagcttagtggaaaacgaagtcaaaaacatcaaagaaacccaacaaatcatc
tttaaaaagaaagaagatctcgtggaaaaaaccgagcctaaaatctatagcttttatgaa
aggattagaagatgggcgaaaaacacgagcattgtaacgatcaaaaaacaggcttgtggg
ggttgttttatcagattgaacgataagatttataccgaagtgctaacgagtggcgatatg
atcacttgcccgtattgcgggcgtattttatacgctgagagcgcgtatgaaaacagcgct
caacctccaaaagaaagccaagaattagtttga

DBGET integrated database retrieval system