KEGG   Helicobacter pylori F32: HPF32_0404Help
Entry
HPF32_0404        CDS       T01911                                 

Gene name
lgt
Definition
(GenBank) prolipoprotein diacylglyceryl transferase
  KO
K13292  phosphatidylglycerol---prolipoprotein diacylglyceryl transferase [EC:2.5.1.145]
Organism
heq  Helicobacter pylori F32
Brite
KEGG Orthology (KO) [BR:heq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HPF32_0404 (lgt)
Enzymes [BR:heq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.145  phosphatidylglycerol---prolipoprotein diacylglyceryl transferase
     HPF32_0404 (lgt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LGT UPF0697 OHA MRP-S22 FixQ
Motif
Other DBs
NCBI-ProteinID: BAJ57986
UniProt: E6NNR0
Position
422299..423153
Genome map
AA seq 284 aa AA seqDB search
MNAWNTIYDQFNPIAFSLGSIEVHWYGLAYACAIVTAFYMALRMIQKDPKRFPIERKEFE
SYFLWAELGIVLGARVGYILIYEPNSSYYLTHFWQIFNPFDSNGDFVGIRGMSYHGGLVG
FLIASYLYSRKDLKKLLIYLDLIAISLPLGYVFGRIGNFLNQELVGRIVPKDSHLGQIIG
IMVDHELRYPSQLIEAFLEGVIVFLMVLWAKKHTKTHGLLIVVYGLGYSLMRFIAEFYRE
PDSQMGVYFLNLSMGQILSLLMVIVSLGILLYATKNSKKIKENQ
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcttggaatacgatttatgatcaatttaaccctatcgcttttagtcttggcagt
attgaagtgcattggtatggtttggcgtatgcgtgcgcgattgttaccgctttttatatg
gcgttacgaatgatccaaaaagaccccaagcgattccccattgaaaggaaggaatttgag
agttattttctatgggcggagcttggcatcgtgctaggggcaagggtaggatacattctt
atttatgagcctaattccagctattatttgacgcatttttggcaaatttttaaccctttt
gatagcaatggggattttgtaggcattcgtgggatgagctatcatggggggttggtgggg
tttttgatcgcttcgtatctttatagccgtaaggatttaaaaaagcttttgatttatttg
gatttgattgcgattagcctgcctttagggtatgtttttgggaggattgggaatttttta
aaccaggagcttgtggggagaattgtccccaaagacagccatttagggcaaatcatagga
attatggtagatcatgaattgcgctatcccagccaattgattgaagcgtttttagagggg
gttattgtgtttttaatggtgctgtgggctaaaaaacacaccaaaacacatgggttactt
attgtggtttatggcttggggtattccttgatgcgctttattgcggaattttacagagag
ccagacagccaaatgggggtttattttttaaatttgagcatggggcagattttaagcttg
cttatggtaattgtttcgttagggattttattgtatgctacgaaaaattctaaaaaaata
aaggaaaatcaatga

DBGET integrated database retrieval system