KEGG   Helicobacter pylori F32: HPF32_0405Help
Entry
HPF32_0405        CDS       T01911                                 

Definition
(GenBank) oxygen-insensitive NADPH nitroreductase
Organism
heq  Helicobacter pylori F32
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: BAJ57987
UniProt: E6NNR1
Structure
PDB: 

Position
423150..423782
Genome map
AA seq 210 aa AA seqDB search
MKFLDQEKRRQLLNERHSCKMFDSHYEFSSEELKEIAEIARLSPSSYNTQPWHFVMVTNK
DVKKQIAAHSYFNEEMIKSASALMVVCPLRPSELLPHGHYMQNLYPESYKVRVIPSFAQM
LGVRFNHSMQKLESYILEQCYIAVGQICMGVSLMGLDSCIIGGFDPLKVGEILEERINKP
KIACLIALGKRVAEASQKTRKSKVDAITWL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttttggatcaagaaaaaagaagacaattactaaacgagcgccattcttgcaag
atgtttgatagccattatgagttctctagcgaagaattaaaagaaatcgctgaaatcgcc
agactatcgccaagctcttacaacacgcagccatggcattttgtgatggttactaataag
gatgtaaaaaaacaaattgcagcacacagctattttaatgaagaaatgattaaaagcgct
tcagcgttaatggtggtatgccctttaagacctagcgagttgttaccacacggccattac
atgcaaaacctctatccggagtcttataaggttagagtgatcccgtcttttgctcaaatg
cttggcgtgagattcaaccacagcatgcaaaaattggaaagctatattttagagcaatgc
tatatcgctgtggggcaaatttgcatgggcgtgagcttaatgggattggatagttgcatt
attggaggctttgatcctttaaaagtgggcgagattttagaagagcgtatcaataagcct
aaaatcgcatgtttgatcgcattgggtaagagggtggcagaagcgagccaaaaaacaaga
aaatcaaaagttgatgcaattacttggttgtga

DBGET integrated database retrieval system