KEGG   Helicobacter pylori F32: HPF32_0407Help
Entry
HPF32_0407        CDS       T01911                                 

Definition
(GenBank) hypothetical protein
  KO
K03743  nicotinamide-nucleotide amidase [EC:3.5.1.42]
Organism
heq  Helicobacter pylori F32
Pathway
heq00760  Nicotinate and nicotinamide metabolism
Brite
KEGG Orthology (KO) [BR:heq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    HPF32_0407
Enzymes [BR:heq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.42  nicotinamide-nucleotide amidase
     HPF32_0407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CinA PAS_8
Motif
Other DBs
NCBI-ProteinID: BAJ57989
UniProt: E6NNR3
Position
complement(424419..425075)
Genome map
AA seq 218 aa AA seqDB search
MKFKFLNMDNESGFILIEKELKRLNILAQVKEDCIELKGDNIKQARIYLQTLFNSNIVEL
DDHQKSANALIECLKSLGLKIAVAESCSGGLLSHAFTSISGASAVFMGGVVCYNEEVKRK
LLKVNATTLKVFGVYSEECVKEMLLGVFLNFKADLALAMSGVAGPNGGSKANPVGTIYIG
AQKLGTQALIDRCFFEGNRESIQNKSVEHALNMLARML
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaaatttttgaatatggataatgagagcggttttattttgattgaaaaagaa
ttgaaacgattgaatattctcgctcaagtcaaagaagattgcattgaattaaaaggcgat
aatatcaaacaagcaagaatctatcttcaaacgctttttaactccaatattgtggaatta
gacgatcaccaaaaaagcgcaaacgctttaatagagtgcttgaaatctttaggtttaaaa
attgcggtggctgaaagctgctctggggggttattatcgcatgcattcacttccattagt
ggggcttcagcggtttttatggggggtgttgtgtgttacaatgaagaggttaagcgcaaa
ttattgaaagtcaatgccacgactttaaaagtctttggggtttatagcgaagaatgcgtg
aaagaaatgctactaggcgtgtttttgaattttaaagcggatttagcgcttgcgatgagt
ggggtggctggccctaatggagggagcaaggctaatcctgtaggcacaatttatattggt
gcacaaaagttaggaactcaagctttaattgatcgctgtttttttgaagggaacagagaa
agcattcaaaataaaagcgtagagcatgccctaaacatgctcgctagaatgctataa

DBGET integrated database retrieval system