KEGG   Helicobacter pylori F32: HPF32_0410Help
Entry
HPF32_0410        CDS       T01911                                 

Definition
(GenBank) hypothetical protein
  KO
K00783  23S rRNA (pseudouridine1915-N3)-methyltransferase [EC:2.1.1.177]
Organism
heq  Helicobacter pylori F32
Brite
KEGG Orthology (KO) [BR:heq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:heq03009]
    HPF32_0410
Enzymes [BR:heq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.177  23S rRNA (pseudouridine1915-N3)-methyltransferase
     HPF32_0410
Ribosome biogenesis [BR:heq03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    HPF32_0410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SPOUT_MTase
Motif
Other DBs
NCBI-ProteinID: BAJ57992
UniProt: E6NNR6
Position
426663..427115
Genome map
AA seq 150 aa AA seqDB search
MRCVVYSIAKSSPLELVKIYQKQCKQFDCELELVDLFPKNTANAQKVSKELAQKSYSLAF
GPYLNPKAKNIALHPKAQRGDSFAFSKMLENHLNINFFIAGAYGFEENFLKDCQAWSLSK
MTFSHEVAKIVLCEQIYRALSIIFKHPYHK
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgcgtggtgtattctatcgctaaaagttcgcctttagagttagtgaaaatctat
caaaagcaatgcaagcaatttgattgcgagctggaattagtggatttattccctaaaaat
accgccaacgctcaaaaagtttctaaagaactcgctcaaaaaagctactctctagccttt
gggccgtatttaaaccctaaggcaaaaaatattgccttacaccctaaagctcaaaggggc
gatagctttgcgtttagtaaaatgttagaaaatcatcttaatattaatttttttatcgct
ggagcgtatgggtttgaagaaaattttttaaaggattgtcaagcttggagtttgagcaag
atgacttttagccatgaagtggctaaaattgtcttatgcgagcaaatctatagggcttta
agcattatttttaagcatccataccataaatag

DBGET integrated database retrieval system