KEGG   Helicobacter pylori F32: HPF32_0415Help
Entry
HPF32_0415        CDS       T01911                                 

Definition
(GenBank) hypothetical protein
  KO
K09022  2-iminobutanoate/2-iminopropanoate deaminase [EC:3.5.99.10]
Organism
heq  Helicobacter pylori F32
Brite
KEGG Orthology (KO) [BR:heq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HPF32_0415
Enzymes [BR:heq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.10  2-iminobutanoate/2-iminopropanoate deaminase
     HPF32_0415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_L-PSP RPN13_C
Motif
Other DBs
NCBI-ProteinID: BAJ57997
UniProt: E6NNS1
Position
432148..432525
Genome map
AA seq 125 aa AA seqDB search
MKEVIHSTLAPKAIGPYSQAIATNDLVFVSGQLGIDASTGEFKGTDIHSQTTQSMENIKA
ILKEAGLGMDSVVKTTILLKSLDDFSVVNEIYGSYFKEPYPARATFQVAKLPKDALVEIE
AIAIK
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtcattcattcaacgctagccccaaaagcgataggcccttattctcaagct
atcgctactaacgatcttgtttttgtctctgggcaattaggtattgatgcaagcaccggc
gaatttaaaggcacggatattcattctcaaaccacgcagtcaatggaaaatatcaaagcg
attttaaaagaagcagggttagggatggatagtgtggttaaaacgactattttattgaaa
agtttagacgatttttcggtggtgaatgaaatctatgggagttattttaaagagccttat
ccagccagagcgacttttcaagtggctaaactgcctaaagacgctttagtagaaattgaa
gcgatagccattaagtga

DBGET integrated database retrieval system