KEGG   Helicobacter pylori F32: HPF32_0418Help
Entry
HPF32_0418        CDS       T01911                                 

Gene name
alr
Definition
(GenBank) alanine racemase, biosynthetic
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
heq  Helicobacter pylori F32
Pathway
heq00473  D-Alanine metabolism
heq01100  Metabolic pathways
heq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:heq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPF32_0418 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    HPF32_0418 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:heq01011]
    HPF32_0418 (alr)
Enzymes [BR:heq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HPF32_0418 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:heq01011]
 Precursor biosynthesis
  Racemase
   HPF32_0418 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: BAJ58000
UniProt: E6NNS4
Position
435179..436312
Genome map
AA seq 377 aa AA seqDB search
MLKRASFVEVNSASLRHNFSAVKSIVPKDAHIMAVVKANAYGAGAIKASEIFLQEGANYL
GVATLDEALELRSHFSKTPILILGYSPNANASMLIDNDLSAMIFSLEQAEVFSQMALKSQ
KRLKIHLKIDTGMHRLGLEPNFKSIEIIKKIRALKGLEIEGIFTHLSNADAKIKTHAKNQ
MKAFNAFLEQLLNQKIEFQYRHAYNSAGILSLCNGNENRLLNLYRPGIMLYGFYPSNGMK
ETCPTILKNVISLKAQIVQIRSVKKGEFIGYGEHFYTNEETLVGVLALGYADGLMRALGN
RIQVAINNQLAPLIGKVCMDQCFVKLNNIQAKEGDEVILFGDKSAKANDASEIAALLNTI
PYETISTLSKRLERVYI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaagggcgagttttgtagaagtgaatagcgcttctttaaggcataattttagc
gcagtcaaaagcattgtccctaaagacgcccatatcatggcggttgtcaaggcgaacgct
tatggggcaggggcaataaaagcgagcgaaatttttttacaagaaggggctaattatcta
ggggtagcgaccttagatgaagctttagagttgcgctctcatttttctaaaacccccatt
ttgattttaggctatagccctaatgctaacgcttccatgctgattgataacgatttgagc
gctatgatttttagccttgaacaagcggaagttttttctcaaatggctttaaaatctcaa
aaacgcttaaaaatccatctcaaaattgataccggcatgcaccgcttgggattagagcct
aattttaaaagcatagaaatcattaaaaaaatccgcgctttaaagggcttggaaatagag
gggatattcacgcatttaagcaacgctgacgctaagattaaaacccatgctaaaaaccaa
atgaaagcctttaacgcttttttagagcagcttttaaatcaaaaaatagagtttcaatac
cgccatgcctacaattccgccggtatcctttctttgtgtaatgggaatgaaaatcgcttg
ttaaatctctatcgcccaggcatcatgctctatggtttttacccttctaatggcatgaaa
gaaacatgcccaaccattttaaaaaatgttatcagtttaaaagctcaaatcgttcaaatc
agaagcgttaaaaaaggcgaatttattggctatggcgagcatttttacaccaatgaagag
actttagtgggcgttttagctctagggtatgcggacgggttaatgcgcgctttaggcaat
cgcattcaggtagcgatcaataaccaattagccccccttattggcaaggtgtgcatggat
caatgttttgtcaaactcaataatattcaagccaaagagggcgatgaggtcatcttgttt
ggggataaaagcgctaaggctaatgacgcaagcgaaatcgctgcacttttaaacaccatt
ccttatgaaaccatcagcaccctatccaaacgcttggagcgcgtctatatttaa

DBGET integrated database retrieval system