KEGG   Helicobacter pylori F32: HPF32_0429Help
Entry
HPF32_0429        CDS       T01911                                 

Gene name
htpX
Definition
(GenBank) heat shock protein HtpX
  KO
K03799  heat shock protein HtpX [EC:3.4.24.-]
Organism
heq  Helicobacter pylori F32
Brite
KEGG Orthology (KO) [BR:heq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:heq01002]
    HPF32_0429 (htpX)
Enzymes [BR:heq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     HPF32_0429 (htpX)
Peptidases [BR:heq01002]
 Metallo Peptidases
  Family M48: Ste24 endopeptidase family
   HPF32_0429 (htpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M48 Peptidase_M56 SprT-like
Motif
Other DBs
NCBI-ProteinID: BAJ58011
UniProt: E6NNT5
Position
complement(445159..446091)
Genome map
AA seq 310 aa AA seqDB search
MTNFEKIIAQNRIKTNAVLATYCVIFAFIGLLVDVIRINANDLGIALFKLMTFQIFPTIT
IIMFLVAFVIIVVCIQNFSSIMLSGDEYKLIDTSKVLSSKENQIHRLLLELLEEAKLHFE
PKLYIINAPYMNAFASGWNESNSLIALTSALIERLDRDELKAVIAHELSHIRHNDIRLTM
CVGILSNIMLLVANFSVYFFMGNRKNSGANLARMILLALQIILPFLTLILQMYLSRTREY
MADSGAAFLMHDNKPMIRALQKISNDYKENDYKDTDKNSTRSAAYLFSAEMFSTHPSIKN
RIQSLSRRVI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacgaattttgaaaagattatcgcgcaaaacagaatcaaaacgaatgcggttttagcc
acttattgcgtgatttttgcttttatcgggttgttagtggatgtcattagaatcaacgct
aatgatttaggaatagctctttttaaactcatgacttttcaaatttttcctacaattacc
atcatcatgtttttagtggcttttgtcattattgttgtttgtatccaaaattttagctct
atcatgttaagcggtgatgaatacaagcttattgacacaagcaaggttttaagctctaaa
gaaaatcaaatccatcgccttttgttagagcttttagaagaggctaagcttcattttgag
cctaagctttatatcattaacgccccttacatgaacgcttttgcgagcgggtggaatgaa
tccaattctcttatcgctcttacaagcgctttaatagagagattggatagagacgaattg
aaagccgtgatcgctcatgagctcagccatatcaggcacaacgacatccgcttgaccatg
tgcgtggggattttaagcaatatcatgctgttagtggctaattttagcgtgtattttttc
atggggaatcgcaagaatagtggggcgaatttagcccgaatgattttattggctttacag
attattttgccttttttaacgcttattttgcaaatgtatttgagccgcacacgagaatac
atggccgatagcggggcggcgtttttaatgcatgacaataagcccatgattagagcctta
caaaaaatttctaacgattacaaagaaaacgattataaagacacagataaaaatagcacc
cgatcggcggcttatctttttagcgctgaaatgtttagcacccaccctagcattaaaaat
cgtatccaatctttatcaaggcgcgtcatttaa

DBGET integrated database retrieval system