KEGG   Helicobacter pylori F32: HPF32_0430Help
Entry
HPF32_0430        CDS       T01911                                 

Gene name
truD
Definition
(GenBank) tRNA pseudouridine synthase D
  KO
K06176  tRNA pseudouridine13 synthase [EC:5.4.99.27]
Organism
heq  Helicobacter pylori F32
Brite
KEGG Orthology (KO) [BR:heq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:heq03016]
    HPF32_0430 (truD)
Enzymes [BR:heq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.27  tRNA pseudouridine13 synthase
     HPF32_0430 (truD)
Transfer RNA biogenesis [BR:heq03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    HPF32_0430 (truD)
 Prokaryotic Type
    HPF32_0430 (truD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruD GutM
Motif
Other DBs
NCBI-ProteinID: BAJ58012
UniProt: E6NNT6
Position
complement(446078..447223)
Genome map
AA seq 381 aa AA seqDB search
MNLNFMPLLHAYNHASIDFHFNSSARDFCVHEVPLYEFSNTGEHAVIQVRKSGLSTLEML
QIFSQILGVKIAELGYAGLKDKNALTTQFVSLPKKYAPLLEKNTSNFQERNLKILSLNYH
YNKIKLGHLKGNRFFMRFKKMTPLNAQKTEQVLEQIAQFGMPNYFGSQRFGKFNDNHQEG
LKILQNQTKFAHQKLNAFLISSYQSYLFNALLSKRLEISKIISAFSLKENLEFFKQKNSN
INSNTLKALKNQAHPFKILEGDVMCHYPYGKFFDALELEKESERFLKKEVSPTGLLDGKK
ALYAKNLSLEIEKEFQHNLLNSHAKTLGSRRFFWVFAENVTSQYVKEKAQFELGFYLPKG
SYASALLKEIKHEKGENNDEF
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaactttatgcccttattgcatgcttataaccatgcgagcattgattttcat
ttcaattctagcgctagggatttttgcgtgcatgaagtgcctttgtatgaatttagcaac
acgggcgaacatgccgttattcaagtgagaaaaagcggtttaagcactttagaaatgctt
caaattttttctcaaattttaggggtaaaaatcgctgaattgggttatgcgggcttgaaa
gataaaaacgcgctgacgactcaattcgtctcactccctaaaaaatacgcccctttatta
gaaaaaaatacgagcaactttcaagaaagaaaccttaaaatcctgtctttgaattaccat
tataataaaatcaaattagggcatttgaaagggaatcgcttttttatgcgttttaaaaaa
atgacccccctaaacgctcaaaaaacggagcaggttttagaacaaatcgcgcagtttggc
atgcctaattattttggatcgcaacgctttgggaagttcaatgacaaccaccaagagggt
ttaaaaatcttgcaaaatcaaacgaaattcgcccatcaaaaattaaacgcttttttaatt
tcaagctatcaaagttatttgtttaacgcgcttttaagcaaacgattagaaatcagtaaa
atcattagcgcttttagcctgaaagaaaatttagaatttttcaaacaaaaaaattcaaat
atcaattcaaacaccctaaaagcccttaaaaaccaagcccacccctttaaaatcttagaa
ggcgatgtgatgtgccattacccttatgggaagttttttgacgctttagaattagaaaaa
gagagcgaaaggtttttgaaaaaagaagtttcacctacggggttattagacggcaaaaaa
gctctttatgcaaaaaatttgagtttagaaattgaaaaagaattccagcataacctttta
aatagccatgctaaaacgctaggctccaggcggtttttttgggtgtttgcagaaaatgta
acttctcaatacgtgaaagaaaaagcgcaatttgaattgggattttacttgcctaaaggg
agttatgcgagcgcgttactcaaagaaatcaagcatgagaaaggagaaaataatgacgaa
ttttga

DBGET integrated database retrieval system