KEGG   Helicobacter pylori F32: HPF32_0437Help
Entry
HPF32_0437        CDS       T01911                                 

Gene name
carB
Definition
(GenBank) carbamoyl phosphate synthase large subunit
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
heq  Helicobacter pylori F32
Pathway
heq00240  Pyrimidine metabolism
heq00250  Alanine, aspartate and glutamate metabolism
heq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:heq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    HPF32_0437 (carB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HPF32_0437 (carB)
Enzymes [BR:heq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     HPF32_0437 (carB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 CPSase_L_D3 MGS ATP-grasp ATP-grasp_3 ATPgrasp_Ter ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: BAJ58019
UniProt: E6NNU3
Position
458559..461816
Genome map
AA seq 1085 aa AA seqDB search
MPKRTDISNILLIGSGPIVIGQACEFDYSGTQSCKTLKSLGYRVILINSNPATVMTDPEF
SHQTYIQPITGENIAAIIKKEKIDAILPTMGGQTALNAVMQMHQKGMLEGVELLGAKIEA
IKKGEDRQAFKEAMLKIGMDLPRGRYAYSELEALEAINEIGFPAIIRASFTLAGGGSGVA
YNIEEFQELAKNALDASPINEILIEESLLGWKEYEMEVIRDSKDNCIIVCCIENIDPMGV
HTGDSITIAPSLTLTDKEYQRMRDASFAILREIGVDTGGSNVQFAIHPETLRMVVIEMNP
RVSRSSALASKATGFPIAKVATMLAVGFSLDEIQNDITNTPASFEPSLDYIVVKIPRFAF
EKFAGVSSTLGTSMKSIGEVMAIGGNFLEALQKALCSLENNWLGFESLSKDLEMIKKEIR
RPNPKRLLYIADAFRLGVCVDEVFELCQIDRWFLSQIQKLVKAEESINSSVLTDTKKLRG
LKNLGFSDARIAAKIKENENLEVSPFEVELARMHLQIVPHFEEVDTCAAEFLSLTPYLYS
TYAPNPLFPIEHKQEKQEKKILIIGSGPNRIGQGIEFDYCCVHASFALKDLNIKSVMLNC
NPETVSTDYDTSDTLYFEPIHFECVKSIIQRERVDGIIVHFGGQTPLKLAKDLAKMQAPI
IGTPFKVIDIAEDREKFSLFLKELDIKQPKNGMAKSIDEAYSIANVIGFPIIVRPSYVLG
GQHMQILENIEELHHYLESVTHALEVSPKNPLLIDKFLEKAVELDVDVICDKKEVYIAGI
LQHIEEAGIHSGDSACFIPSTLSPEILDEIERVSAKIALHLGVVGLLNIQFAVHHNSLYL
IEVNPRASRTVPFLSKALGVPLAKVATRVMVLKDLKEALKFYDKKNIVGYSKGVYKPKMP
HFVALKEAVFPFNKLYGSDLILGPEMKSTGEVMGIARSLGLAFFKAQTACFNPIKNKGLI
FVSIKDKDKEEACVLMKRLVQLGFELCATEGTHKALEKAGVESLKVLKISEGRPNVMDLM
MNGEISMAINTSDHKSQDDAKLIRASVLKNHVSYFTTLSAIEVLILALEESSKEDELLAL
QDYLV
NT seq 3258 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaacgcaccgatatttccaacattctactgataggatcaggccctattgtgatc
gggcaagcttgcgagtttgactactcagggactcaaagttgtaaaaccctaaaatcttta
ggttatagagtgatcttaatcaattctaacccggccaccgtgatgactgaccctgaattt
tctcatcaaacttatatccaacccatcactggagaaaatatcgccgctatcatcaaaaaa
gaaaagattgacgctattttacccacaatgggcgggcaaaccgctttgaatgcggtcatg
caaatgcaccaaaagggcatgttagaaggcgtggagcttttaggggctaagattgaagcg
attaaaaaaggcgaagacaggcaggctttcaaagaagcgatgttaaaaatcgggatggat
ttgcctagagggcgttacgcttatagcgagttagaagccctagaagccattaatgaaatt
ggctttccagccattattagagcgagtttcactctggctggtggggggagtggggtcgct
tataatattgaagagtttcaagaattggctaaaaacgccctagacgcttcgcccattaat
gaaattttgattgaagagtccttattggggtggaaagaatatgaaatggaagtcatacga
gacagcaaggacaattgcatcattgtgtgctgtattgaaaatattgaccccatgggcgtt
cataccggcgatagcatcaccatcgctccaagcctaaccttaaccgataaagaataccaa
cgcatgcgcgatgcgagctttgcgattttgagagaaattggcgtggatactggcgggagt
aatgtgcagtttgctatccacccagagactttaagaatggttgtgattgaaatgaaccca
cgagtgagccgcagctctgcattagcttcaaaagcgaccgggtttcccattgcaaaagtg
gctaccatgcttgcggtgggttttagcttagatgaaatccaaaacgatattaccaacacc
ccagcgagttttgagcctagtttagattatatcgtggtgaaaattcctcgctttgcgttt
gaaaaatttgccggtgtttctagcactttagggacttctatgaaaagcattggtgaagtg
atggcgataggggggaatttcttagaagccctacaaaaagcgttatgctctttggaaaac
aattggctagggtttgaatcgttaagcaaagatttagaaatgataaaaaaggaaatccgc
cggcccaatcccaaacgcttgctctatatcgctgatgcgttcaggcttggcgtttgtgtt
gatgaagtgtttgaattatgccagattgacaggtggtttttatctcaaatccaaaagcta
gtcaaagcagaagaaagcatcaattctagtgttttaacggacaccaaaaaattaagaggg
cttaaaaatttaggctttagcgatgccaggattgccgctaaaatcaaagaaaatgaaaat
ttagaggtgagtccttttgaagtggaattagccagaatgcatttacaaatcgtgccccat
tttgaagaagtggacacttgcgcggcggagtttttatcgctcacgccttatttgtattcc
acctatgcccctaaccctttgtttcctattgaacacaaacaagaaaaacaagaaaagaaa
atcctaatcataggctctgggcctaatcgcatcggtcaaggcattgaatttgattattgt
tgcgtgcatgcgagctttgccttaaaagatttaaacattaaaagcgtcatgctcaattgc
aatccagaaacggttagcacagattatgataccagcgacacgctctattttgaacccatt
cattttgagtgcgtgaagagcatcattcaaagggagcgcgtggatggcattatcgtgcat
tttgggggacaaacccctttaaaactcgctaaagatctagccaaaatgcaagcccccatt
attggcacgccttttaaggtgattgatattgctgaagacagggaaaaattttccctcttt
ttaaaagagcttgacattaagcagcccaaaaacggcatggctaagagtattgatgaagct
tatagcatcgctaatgtgattggtttccctattatcgtgcgccctagttatgtgctaggc
ggtcaacacatgcaaattttagaaaatattgaagaactgcaccattatttagaaagcgtt
acgcatgctttagaggttagccctaaaaatccgctcctcattgataagtttttagaaaaa
gcggtggaactagatgtggatgtgatttgcgataaaaaagaggtttatattgccggcatt
ttacagcatattgaagaagccggaatccattcaggcgattcggcatgctttatcccttcc
actttaagccctgaaattttagatgaaattgagcgagtgagtgcaaaaatcgctctgcat
ttaggcgtagtagggctattgaatatccaatttgctgtgcatcacaattcgctctatttg
attgaagtcaatcccagagccagccgaaccgtgccttttttaagcaaggctttaggcgtt
cctttagccaaagttgcgactagggttatggtgttaaaagatttgaaagaagccttgaag
ttctatgataaaaaaaatatcgtgggatattctaaaggcgtttataagcctaaaatgccc
cattttgtggctttaaaagaagcggttttcccttttaataaactttatggatcggatttg
attttagggcctgagatgaaaagcaccggcgaagtgatggggattgctagatctttaggg
ttggcttttttcaaggctcaaacggcttgctttaaccccattaaaaacaaggggcttatt
tttgtttctattaaagataaggataaagaagaagcatgcgttttaatgaagcgcttggtt
cagttaggctttgaattgtgcgctacagaaggcacgcataaagctttggaaaaagccggg
gtagagtctttgaaagtgcttaaaatctccgaaggtcgccccaatgtcatggatttaatg
atgaatggggaaatcagcatggctatcaacaccagcgatcacaaatctcaagatgacgcc
aaactcattcgcgcttctgtgcttaaaaatcatgtgagttatttcacaactttaagcgcg
atagaagttttgattttagcgttagaagaaagctctaaagaagacgagttgttagcctta
caagattatttagtttga

DBGET integrated database retrieval system