KEGG   Helicobacter pylori F32: HPF32_0441Help
Entry
HPF32_0441        CDS       T01911                                 

Gene name
alpB
Definition
(GenBank) outer membrane protein AlpB
  KO
K15844  outer membrane protein HopB/AlpB
Organism
heq  Helicobacter pylori F32
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HP_OMP
Motif
Other DBs
NCBI-ProteinID: BAJ58023
UniProt: E6NNU7
Position
complement(467188..468765)
Genome map
AA seq 525 aa AA seqDB search
MKQNLKPFKMIKENLMTQSQKVRFLAPLSLALSLSFNQVGAEEDGGFMTFGYELGQVVQQ
VKNPGKIKAEELAGLLNSTTTNNTNINIAGTGGNVAGTLGNLFMNQLGNLIDLYPTLNTG
NIRQCNSGSASGATTAAATTSNSPCFQGNLSLYNEMVSSIKTLSQDLKNNIFQGNNNTTS
ANLSNQLSELNTASVYLTYMNSFLNANNQAGGIFQNNTNQAYGVTAQQIAYVLRQASITM
GPSGNGGAAGAFLDAALAQHVFNSANAGNDLSAKEFTSLVQNIVNTSQNALTLANNANIS
NSTGYQVSYGGNIDQARSTQLLNNTTNTLAKVAALNNELKANPWLGNFAAGNSSQVNAFN
GFITKIGYKQFFGENKNVGLRYYGFFSYNGAGVGNGPTYNQVNLLTYGVGTDVLYNVFSR
SFGSRSLNAGFFGGIQLAGDTYISTLRNSPQLASRPTATKFQFLFDVGLRMNFGILKKDL
KSHNQHSIEIGVQIPTIYNTYYKTGGAEVKYYRPYSVYWVYGYAF
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaatttaaagccattcaaaatgattaaggaaaatttaatgacacaatctcaa
aaagtaagattcttagcccctttaagcctagcgttaagcttgagcttcaatcaagtgggc
gctgaagaagatgggggctttatgacctttgggtatgaattaggtcaggtagtccaacaa
gtgaaaaacccgggtaaaatcaaagccgaagaattagccggcttgttaaactctaccacg
acaaacaacaccaatatcaatattgcaggcacaggaggcaatgtcgccgggactttaggc
aacctctttatgaaccaattaggcaatttgattgatttgtatcccactttgaacactggg
aatatccgtcaatgtaatagtggtagcgctagtggtgctactaccgctgctgctactact
agcaatagtccttgtttccaaggtaacctgagtctttataacgaaatggttagctccatc
aaaactttgagtcaagatctcaaaaacaatatctttcaaggcaacaacaacaccacgagc
gcgaacctctccaatcagctcagtgagcttaacaccgctagcgtttatttgacttacatg
aactcattcttaaacgccaataaccaagcgggtgggatttttcaaaacaacactaatcaa
gcttatggtgttaccgctcaacaaatcgcttatgtcctaaggcaagcttcaatcactatg
gggccaagcggtaatggtggggctgccggtgcgtttttggacgccgctttagcgcagcat
gttttcaactcggctaacgctgggaatgatttgagcgctaaggaattcactagtttggtg
caaaatatcgtcaatacttctcaaaacgctttaacgctggccaacaacgctaacatcagc
aattcaacaggctatcaagtgagctatggcgggaatattgatcaagcgcgctctacccaa
ctattaaacaacaccacaaacactttggctaaagttgccgctttgaataacgagcttaaa
gctaacccatggcttgggaatttcgctgccggtaacagctctcaagtgaatgcgtttaac
gggtttatcactaaaatcggttataagcaattctttggagaaaacaagaatgtgggctta
cgctactacggcttcttcagctataacggcgcgggcgtgggtaatggccctacttacaat
caagtcaatttgctcacttatggggtgggaactgatgtgctttacaatgtgtttagccgc
tcttttggcagccgaagtcttaatgcgggcttctttggggggatccaactcgcaggggat
acttacatcagcacgctaagaaatagccctcagcttgcgagcagacccacagcgacaaaa
ttccaattcttgtttgatgtggggttacgcatgaactttggtatcttgaaaaaagacttg
aaaagccataaccagcattctatagaaatcggtgtgcaaatccctacgatttacaacact
tattataaaactggcggtgctgaagtgaaatactaccgcccttatagcgtgtattgggtc
tatggctacgccttctaa

DBGET integrated database retrieval system