KEGG   Helicobacter pylori F32: HPF32_0442Help
Entry
HPF32_0442        CDS       T01911                                 

Gene name
alpA
Definition
(GenBank) outer membrane protein AlpA
  KO
K15843  outer membrane protein HopC/AlpA
Organism
heq  Helicobacter pylori F32
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HP_OMP
Motif
Other DBs
NCBI-ProteinID: BAJ58024
UniProt: E6NNU8
Position
complement(468787..470331)
Genome map
AA seq 514 aa AA seqDB search
MIKKNRTLFLSLALCASISYAEDDGGFFTVGYQLGQVMQDVQNPGGTKRDELERELNAGV
TNNILGNNTGGNVAGALSNAFSQYLYSLLGAYPEKLNGNDVSANALLGGAVGSGTCAAAG
TAGSNSLNTQSACTAAGYYWLPSLSNRVLSTIGSQTNYGTDTNFPNMQQQLTYLNAANVF
FNAMNKALETKNGTSGATGSNGQTYSSQAIQYLQDQQHILNNAANLLKQDELLLEAFNSA
VAANIGNKEFNSAVFTGLVQGIIDQSQSVYNELNKNPISGSAFNNATNNQLTNQANAVQG
RANQLSNALYNAQVTLDKINALNNQVKSMPYLPQFRAGNSRSTNILNGFYTKVGYKQFFG
KKRNIGLRYYGFFSYNGASVGFRSTQNNVGLYTYGVGTDVLYNIFSRSYQNRSVDMGFFN
GIQLAGETFQSTLRDDPNVKLHGKVNNTHFQFLFDFGMRMNFGKLDGKSNRHNQHTVEFG
VVVPTIYNTYYKSAGTTVKYFRPYSVYWSYGYSF
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgataaagaaaaatagaacgctgtttcttagtctagccctttgcgctagcataagttat
gccgaagatgatggagggtttttcaccgtcggttatcagctcgggcaagtcatgcaagat
gtccaaaacccaggcggcactaaaagagatgaactcgaaagagagcttaacgctggtgta
acgaacaacattttaggcaacaacaccggaggcaatgtcgcaggggcgttgagtaacgct
ttctcccaatacctttattcgcttttgggggcgtatccagagaaactcaatggtaacgat
gtgtctgcgaacgctcttttagggggtgcggtaggcagtgggacttgtgcggctgcaggg
acggctggcagcaattctcttaacacccaaagcgcttgcaccgctgcgggctattactgg
ctcccaagcctttctaacagggttttaagcacgatcggtagccagactaactacggcacg
gacaccaatttccccaacatgcaacaacagctcacctacttgaatgcggcgaatgtgttt
tttaatgcgatgaataaggctttagagaccaaaaatggaactagtggtgcgactggttca
aatggtcaaacttactcttcacaagctattcaataccttcaagaccaacaacatattctc
aataacgcagccaacttgctcaagcaagatgaattgctcctagaagctttcaactctgcc
gtagccgccaacattgggaataaggaattcaattcagccgtttttacaggtttggtgcaa
ggcattatcgatcaatcccaatcggtttataacgaactcaataaaaaccccattagcggg
agtgcgtttaataacgctacaaataaccaactaactaaccaagctaacgctgtgcaaggg
cgcgctaatcagctctctaacgctctttataacgcgcaagtaactttggataaaatcaat
gcgctcaataatcaggtgaaaagcatgccttacttgccccaattcagggccgggaacagc
cgttcaacgaatattttaaacgggttttacactaaagtgggctataagcaattcttcggg
aagaaaaggaatatcggtttgcgctattatggtttcttttcttataacggagcgagcgtg
ggctttagatccactcaaaataatgtagggttatacacttatggggtggggactgatgtg
ttgtataacatctttagccgctcctatcaaaaccgctctgtggatatgggcttttttaac
ggtatccaattagccggtgaaaccttccaatccacgctcagagatgaccccaatgtgaaa
ttgcatgggaaagtcaataacacgcacttccagttcctctttgacttcggtatgcggatg
aacttcggtaagttggatgggaaatccaaccgccacaaccagcacacggtggaatttggc
gtagtggtgcctacgatttataacacttattacaaatcagcagggactaccgtgaagtat
ttccgtccttatagcgtttattggtcttatgggtattcattctaa

DBGET integrated database retrieval system