KEGG   Helicobacter pylori F32: HPF32_0448Help
Entry
HPF32_0448        CDS       T01911                                 

Definition
(GenBank) hypothetical protein
Organism
heq  Helicobacter pylori F32
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flg_hook RIH_assoc
Motif
Other DBs
NCBI-ProteinID: BAJ58030
UniProt: E6NNV4
Position
complement(477556..479121)
Genome map
AA seq 521 aa AA seqDB search
MPSPINPIHTNASTNANALNNGAKNGVKDTKNAPKSASKDFSKILNQKISKDKTAPKESP
SALKALPKDAKKDAKELEKTPTPHHQHAQNLAKDQQAPTLKDLLNHKKTTASHEAQHEIH
KNHETNPKTPNETLNKNEKKPNGVISSAHQANLTNKNPLAPTNHANNAIKNPTAPTHNAK
DPKTLKDIQTLSQKHDLNASNIQVGTPLEKKETPLNASDQLALKTTQTPINHTLAKNDAK
NTANLSSVLQSLEKKESHNKERATPPSNEKKTPPLREALQMNAIKRDKTLSKKKPEKTPT
KTQTTAPSTTPENAPKIPLKTPPLMPLIGANPPNDNAPTLLEKEEKAKEVSENKEKTKES
TNSAQSAQNAQASDKTSENKSTAPKETIKHFTQQLKQEIQEYKPPMSRISMDLFPKELGK
VEVTIQKVGKNLKVSVISHNNSLQTFLDNQQDLKNSLNALGFEGVDLSFSQDSSKEQPKE
QLREPFKEQESTPLKENALKSYQENTDNENKETSMQITLYA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgccatctcctattaatcccattcacaccaacgcaagcaccaacgcaaacgctttaaat
aacggagcgaaaaacggagttaaagacaccaaaaacgcccctaaaagcgcatcaaaagat
ttcagtaagatcttaaaccaaaagatctctaaagacaaaaccgcccctaaagaaagtcct
agcgctttaaaagccttgcccaaagacgctaaaaaggacgctaaagagcttgaaaaaacc
cctaccccacaccaccaacacgctcaaaatctcgccaaagaccaacaagcccctacctta
aaagatttgctcaaccacaaaaaaaccaccgcctcgcatgaagctcaacatgagattcat
aaaaaccatgaaactaacccaaaaacccctaacgaaactttaaacaagaatgaaaaaaag
cctaatggagttatttctagcgctcatcaagccaacttgaccaataaaaacccactagcc
cccactaaccacgctaacaacgctatcaaaaaccccacagccccaactcacaacgctaaa
gatccaaaaacccttaaagacatccaaacgctcagccaaaaacatgacttaaacgccagc
aacattcaagtaggcactccgttagaaaaaaaagaaacccccttaaatgcaagcgatcaa
cttgctttaaaaacaacgcaaacacctattaaccacacccttgcaaagaacgacgctaaa
aacaccgccaacctttctagcgttttgcaatccttagaaaaaaaagaatcgcacaataaa
gagcgtgcaaccccccccagtaatgaaaaaaaaacgccccctttaagggaagctttacaa
atgaacgccattaaaagggataaaacgctttctaaaaaaaagccagaaaaaacccctact
aaaacccaaactacagccccaagcacaacgccagaaaatgcccctaaaatccctcttaaa
acgccccctttaatgcctttaataggagctaacccccctaatgataacgctccaacgcta
ttagaaaaagaagaaaaagctaaagaagtgagcgaaaataaagaaaaaactaaagaatcc
actaacagcgctcaaagcgcacaaaacgcccaagctagcgataaaacaagcgagaataaa
agcaccgcccctaaagagacgatcaagcatttcacccaacaattaaagcaagaaatccaa
gaatacaaaccccccatgagcaggatctctatggatttattccctaaggaattgggcaag
gttgaagtaactattcaaaaagtgggtaaaaaccttaaagtgagcgtgatttctcataac
aacagcctgcaaacctttttagacaaccaacaagatctcaaaaacagcctgaacgcttta
ggctttgaaggggtggatttgagcttttcgcaagattcttctaaagagcaacctaaagag
caattaagagagccattcaaagagcaggaatcaacccccttaaaagaaaacgccctaaaa
agctaccaagagaatacggataatgaaaacaaagaaacgagcatgcaaatcactctttat
gcgtga

DBGET integrated database retrieval system